BLASTX nr result
ID: Zingiber25_contig00029338
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00029338 (409 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAJ99870.1| predicted protein [Hordeum vulgare subsp. vulgare] 56 4e-06 ref|XP_003573747.1| PREDICTED: uncharacterized protein LOC100845... 56 6e-06 gb|EXC32478.1| E3 ubiquitin-protein ligase ATL59 [Morus notabilis] 55 7e-06 ref|NP_564425.1| uncharacterized protein [Arabidopsis thaliana] ... 55 7e-06 ref|XP_002269541.1| PREDICTED: uncharacterized protein LOC100248... 55 7e-06 ref|XP_002521748.1| conserved hypothetical protein [Ricinus comm... 55 1e-05 >dbj|BAJ99870.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 190 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/47 (57%), Positives = 34/47 (72%), Gaps = 5/47 (10%) Frame = +3 Query: 3 ALLGWIIAAPFILATLYTLLVPCFKLLVRRF-----SPTNSQEAILL 128 A+LGW++AAPF++A LYTL VPCFK LV RF SP +A+LL Sbjct: 125 AILGWMVAAPFVMAGLYTLSVPCFKYLVSRFGVIPSSPRTPMKAVLL 171 >ref|XP_003573747.1| PREDICTED: uncharacterized protein LOC100845918 [Brachypodium distachyon] Length = 188 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 5/47 (10%) Frame = +3 Query: 3 ALLGWIIAAPFILATLYTLLVPCFKLLVRRF-----SPTNSQEAILL 128 A+LGW+IAAP +LA LYT+L+PCFK LV +F SP + +LL Sbjct: 125 AMLGWVIAAPLVLAVLYTMLIPCFKFLVNKFGIIPSSPRTPSKVVLL 171 >gb|EXC32478.1| E3 ubiquitin-protein ligase ATL59 [Morus notabilis] Length = 333 Score = 55.5 bits (132), Expect = 7e-06 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = +3 Query: 3 ALLGWIIAAPFILATLYTLLVPCFKLLVRRFS 98 ALLGW++A PFILA LY L +PCFK+LVR+FS Sbjct: 127 ALLGWLVAVPFILAALYILFLPCFKILVRKFS 158 >ref|NP_564425.1| uncharacterized protein [Arabidopsis thaliana] gi|12322387|gb|AAG51219.1|AC051630_16 unknown protein; 76034-74699 [Arabidopsis thaliana] gi|26450368|dbj|BAC42300.1| unknown protein [Arabidopsis thaliana] gi|332193479|gb|AEE31600.1| uncharacterized protein AT1G33490 [Arabidopsis thaliana] Length = 175 Score = 55.5 bits (132), Expect = 7e-06 Identities = 22/36 (61%), Positives = 30/36 (83%) Frame = +3 Query: 3 ALLGWIIAAPFILATLYTLLVPCFKLLVRRFSPTNS 110 ALLGW+IAAPF++ LY + +PCFK+LVR+FS +S Sbjct: 129 ALLGWLIAAPFVIVALYIMFLPCFKILVRKFSSVDS 164 >ref|XP_002269541.1| PREDICTED: uncharacterized protein LOC100248177 [Vitis vinifera] gi|297734771|emb|CBI17005.3| unnamed protein product [Vitis vinifera] Length = 185 Score = 55.5 bits (132), Expect = 7e-06 Identities = 24/36 (66%), Positives = 29/36 (80%) Frame = +3 Query: 3 ALLGWIIAAPFILATLYTLLVPCFKLLVRRFSPTNS 110 ALLGW++AAPFIL LY + +PC KLLVR+FSP S Sbjct: 131 ALLGWLVAAPFILVILYIIFLPCCKLLVRKFSPVPS 166 >ref|XP_002521748.1| conserved hypothetical protein [Ricinus communis] gi|223538961|gb|EEF40558.1| conserved hypothetical protein [Ricinus communis] Length = 183 Score = 55.1 bits (131), Expect = 1e-05 Identities = 22/32 (68%), Positives = 29/32 (90%) Frame = +3 Query: 3 ALLGWIIAAPFILATLYTLLVPCFKLLVRRFS 98 AL+GW++AAPFILA LY + +PCFK+LVR+FS Sbjct: 129 ALMGWLVAAPFILAALYIIFLPCFKVLVRKFS 160