BLASTX nr result
ID: Zingiber25_contig00029242
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00029242 (447 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003580688.1| PREDICTED: uncharacterized protein LOC100833... 55 7e-06 >ref|XP_003580688.1| PREDICTED: uncharacterized protein LOC100833033 [Brachypodium distachyon] Length = 316 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/45 (57%), Positives = 30/45 (66%), Gaps = 2/45 (4%) Frame = -3 Query: 445 HDYDREVERVSSGEFLCPENLT--GGTPHLAHFLLRTGAPTDKFC 317 HD++ EVE+V S EFLC EN GTP L HFL+R G P D FC Sbjct: 255 HDFNFEVEQVLSKEFLCDENRVQGSGTPSLGHFLIRAGGPKDSFC 299