BLASTX nr result
ID: Zingiber25_contig00029072
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00029072 (264 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006417587.1| hypothetical protein EUTSA_v10008047mg [Eutr... 64 2e-08 gb|EMJ23839.1| hypothetical protein PRUPE_ppa008534mg [Prunus pe... 60 4e-07 ref|XP_002892498.1| hypothetical protein ARALYDRAFT_471019 [Arab... 59 7e-07 ref|XP_002314747.1| predicted protein [Populus trichocarpa] 59 9e-07 ref|XP_004157853.1| PREDICTED: uncharacterized protein LOC101227... 58 2e-06 gb|AAN41286.1| unknown protein [Arabidopsis thaliana] 57 3e-06 ref|XP_002314748.2| hypothetical protein POPTR_0010s10980g [Popu... 56 4e-06 gb|AAD18100.1| This gene is continued on the 5' end of BAC T12M1... 56 4e-06 ref|NP_172400.2| uncharacterized protein [Arabidopsis thaliana] ... 56 4e-06 ref|XP_006305202.1| hypothetical protein CARUB_v10009568mg [Caps... 56 6e-06 ref|XP_002521883.1| conserved hypothetical protein [Ricinus comm... 56 6e-06 gb|EOY01218.1| Uncharacterized protein TCM_011165 [Theobroma cacao] 55 1e-05 >ref|XP_006417587.1| hypothetical protein EUTSA_v10008047mg [Eutrema salsugineum] gi|557095358|gb|ESQ35940.1| hypothetical protein EUTSA_v10008047mg [Eutrema salsugineum] Length = 354 Score = 63.9 bits (154), Expect = 2e-08 Identities = 31/62 (50%), Positives = 42/62 (67%) Frame = +2 Query: 74 MATAEETNEAKGQSEERAEDRETSRCNSVQKEERMAPWEQHAAVISLPRYDYAAPSSLLH 253 MA AEE ++ G+S E E+ T + + E + PWEQHA++IS+PR+DY APSSLLH Sbjct: 1 MAAAEEVDDVVGKSIE--EEPVTEKRERGDEAETLTPWEQHASIISIPRFDYTAPSSLLH 58 Query: 254 RS 259 S Sbjct: 59 HS 60 >gb|EMJ23839.1| hypothetical protein PRUPE_ppa008534mg [Prunus persica] Length = 328 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/44 (59%), Positives = 33/44 (75%) Frame = +2 Query: 128 EDRETSRCNSVQKEERMAPWEQHAAVISLPRYDYAAPSSLLHRS 259 E+RE + + K+E MAPWEQH+ VIS+PR+DY APSSLL S Sbjct: 4 EEREKEKERELSKKEEMAPWEQHSTVISIPRFDYNAPSSLLQHS 47 >ref|XP_002892498.1| hypothetical protein ARALYDRAFT_471019 [Arabidopsis lyrata subsp. lyrata] gi|297338340|gb|EFH68757.1| hypothetical protein ARALYDRAFT_471019 [Arabidopsis lyrata subsp. lyrata] Length = 348 Score = 58.9 bits (141), Expect = 7e-07 Identities = 29/62 (46%), Positives = 38/62 (61%) Frame = +2 Query: 74 MATAEETNEAKGQSEERAEDRETSRCNSVQKEERMAPWEQHAAVISLPRYDYAAPSSLLH 253 MA AEE N+ EE + R + E + PWEQH+++IS+PR+DY APSSLLH Sbjct: 1 MAAAEELNDVGRTIEEEPVSEKRERGDEA---ETLPPWEQHSSIISIPRFDYKAPSSLLH 57 Query: 254 RS 259 S Sbjct: 58 HS 59 >ref|XP_002314747.1| predicted protein [Populus trichocarpa] Length = 79 Score = 58.5 bits (140), Expect = 9e-07 Identities = 24/47 (51%), Positives = 35/47 (74%) Frame = +2 Query: 119 ERAEDRETSRCNSVQKEERMAPWEQHAAVISLPRYDYAAPSSLLHRS 259 E +++ S+ + ++ERM PWEQHA VI++PR+DY APS+LLH S Sbjct: 12 EEEKEKMESKSEAAAEKERMKPWEQHAGVINMPRFDYNAPSALLHHS 58 >ref|XP_004157853.1| PREDICTED: uncharacterized protein LOC101227649 [Cucumis sativus] Length = 345 Score = 57.8 bits (138), Expect = 2e-06 Identities = 29/58 (50%), Positives = 36/58 (62%), Gaps = 2/58 (3%) Frame = +2 Query: 89 ETNEAKGQSEERAEDRETSRCNSVQKEER--MAPWEQHAAVISLPRYDYAAPSSLLHR 256 ET E + E R +V + ER M PWEQH+AVIS+PR+DY APS+LLHR Sbjct: 3 ETEEQNNGCHLKPEAEAFKRAENVAETERKMMTPWEQHSAVISIPRFDYNAPSALLHR 60 >gb|AAN41286.1| unknown protein [Arabidopsis thaliana] Length = 373 Score = 56.6 bits (135), Expect = 3e-06 Identities = 29/65 (44%), Positives = 40/65 (61%), Gaps = 2/65 (3%) Frame = +2 Query: 71 SMATAEETNEAKGQSEERA--EDRETSRCNSVQKEERMAPWEQHAAVISLPRYDYAAPSS 244 +MA EE ++ EE E RE ++ E + PWEQH+++IS+PR+DY APSS Sbjct: 25 TMAAVEEVDDVGRTIEEETVCEKRERG-----EEAETLTPWEQHSSIISIPRFDYKAPSS 79 Query: 245 LLHRS 259 LLH S Sbjct: 80 LLHHS 84 >ref|XP_002314748.2| hypothetical protein POPTR_0010s10980g [Populus trichocarpa] gi|550329547|gb|EEF00919.2| hypothetical protein POPTR_0010s10980g [Populus trichocarpa] Length = 345 Score = 56.2 bits (134), Expect = 4e-06 Identities = 23/39 (58%), Positives = 31/39 (79%) Frame = +2 Query: 143 SRCNSVQKEERMAPWEQHAAVISLPRYDYAAPSSLLHRS 259 S+ + ++ERM PWEQHA VI++PR+DY APS+LLH S Sbjct: 3 SKSEAAAEKERMKPWEQHAGVINMPRFDYNAPSALLHHS 41 >gb|AAD18100.1| This gene is continued on the 5' end of BAC T12M14, partial [Arabidopsis thaliana] Length = 297 Score = 56.2 bits (134), Expect = 4e-06 Identities = 29/64 (45%), Positives = 39/64 (60%), Gaps = 2/64 (3%) Frame = +2 Query: 74 MATAEETNEAKGQSEERA--EDRETSRCNSVQKEERMAPWEQHAAVISLPRYDYAAPSSL 247 MA EE ++ EE E RE ++ E + PWEQH+++IS+PR+DY APSSL Sbjct: 1 MAAVEEVDDVGRTIEEETVCEKRERG-----EEAETLTPWEQHSSIISIPRFDYKAPSSL 55 Query: 248 LHRS 259 LH S Sbjct: 56 LHHS 59 >ref|NP_172400.2| uncharacterized protein [Arabidopsis thaliana] gi|14334964|gb|AAK59659.1| unknown protein [Arabidopsis thaliana] gi|332190304|gb|AEE28425.1| uncharacterized protein AT1G09290 [Arabidopsis thaliana] Length = 348 Score = 56.2 bits (134), Expect = 4e-06 Identities = 29/64 (45%), Positives = 39/64 (60%), Gaps = 2/64 (3%) Frame = +2 Query: 74 MATAEETNEAKGQSEERA--EDRETSRCNSVQKEERMAPWEQHAAVISLPRYDYAAPSSL 247 MA EE ++ EE E RE ++ E + PWEQH+++IS+PR+DY APSSL Sbjct: 1 MAAVEEVDDVGRTIEEETVCEKRERG-----EEAETLTPWEQHSSIISIPRFDYKAPSSL 55 Query: 248 LHRS 259 LH S Sbjct: 56 LHHS 59 >ref|XP_006305202.1| hypothetical protein CARUB_v10009568mg [Capsella rubella] gi|482573913|gb|EOA38100.1| hypothetical protein CARUB_v10009568mg [Capsella rubella] Length = 355 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/62 (40%), Positives = 36/62 (58%) Frame = +2 Query: 74 MATAEETNEAKGQSEERAEDRETSRCNSVQKEERMAPWEQHAAVISLPRYDYAAPSSLLH 253 MA ++ + EE + R + E + PWEQH+++IS+PR+DY APSSLLH Sbjct: 1 MAAVDDVKDVGRTVEEEPVCEKREREEEEAETEALTPWEQHSSIISIPRFDYKAPSSLLH 60 Query: 254 RS 259 S Sbjct: 61 HS 62 >ref|XP_002521883.1| conserved hypothetical protein [Ricinus communis] gi|223538921|gb|EEF40519.1| conserved hypothetical protein [Ricinus communis] Length = 336 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/52 (50%), Positives = 35/52 (67%) Frame = +2 Query: 104 KGQSEERAEDRETSRCNSVQKEERMAPWEQHAAVISLPRYDYAAPSSLLHRS 259 K + EE +++E +E M PWEQHAA+IS+PR+DY APS+LLH S Sbjct: 14 KSEREEAVKEKE---------KESMKPWEQHAAIISIPRFDYNAPSALLHNS 56 >gb|EOY01218.1| Uncharacterized protein TCM_011165 [Theobroma cacao] Length = 344 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/52 (50%), Positives = 35/52 (67%), Gaps = 1/52 (1%) Frame = +2 Query: 107 GQSEERAEDR-ETSRCNSVQKEERMAPWEQHAAVISLPRYDYAAPSSLLHRS 259 G+ EER + E+ + + M PWEQHA++IS+PR+DY APSSLL RS Sbjct: 2 GEEEERKPVKMESKEEEGEESKTTMTPWEQHASIISIPRFDYKAPSSLLQRS 53