BLASTX nr result
ID: Zingiber25_contig00029036
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00029036 (377 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004150094.1| PREDICTED: zinc finger protein 6-like [Cucum... 56 6e-06 >ref|XP_004150094.1| PREDICTED: zinc finger protein 6-like [Cucumis sativus] gi|449501540|ref|XP_004161397.1| PREDICTED: zinc finger protein 6-like [Cucumis sativus] Length = 137 Score = 55.8 bits (133), Expect = 6e-06 Identities = 35/76 (46%), Positives = 44/76 (57%), Gaps = 3/76 (3%) Frame = -3 Query: 375 FLKSQALGGHQNAHKKERRQLRRRVLLHCPPPAARNQLALCPRSASLAAANWVVGYSPTP 196 F SQALGGHQNAHK+E RQL +++L P +RN LA P S+++ W G +P P Sbjct: 41 FANSQALGGHQNAHKRE-RQLAKQLLPLQPTKHSRNFLASTPPSSTVGI--WSAGRAPPP 97 Query: 195 YYNC---TEAAVYGGG 157 Y AV GGG Sbjct: 98 KYGIQVQARPAVVGGG 113