BLASTX nr result
ID: Zingiber25_contig00028994
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00028994 (289 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN69646.1| hypothetical protein VITISV_022132 [Vitis vinifera] 57 3e-06 >emb|CAN69646.1| hypothetical protein VITISV_022132 [Vitis vinifera] Length = 527 Score = 56.6 bits (135), Expect = 3e-06 Identities = 29/40 (72%), Positives = 33/40 (82%), Gaps = 2/40 (5%) Frame = +1 Query: 175 MQSWWESISKARSRILELVSLLH--LPDLASLADSDRPAR 288 MQSWWESISKAR+RIL L S+L P ++SLADSDRPAR Sbjct: 32 MQSWWESISKARARILALSSILSSPSPSISSLADSDRPAR 71