BLASTX nr result
ID: Zingiber25_contig00028923
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00028923 (471 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006447445.1| hypothetical protein CICLE_v10017232mg [Citr... 58 1e-06 >ref|XP_006447445.1| hypothetical protein CICLE_v10017232mg [Citrus clementina] gi|557550056|gb|ESR60685.1| hypothetical protein CICLE_v10017232mg [Citrus clementina] Length = 115 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/45 (55%), Positives = 34/45 (75%) Frame = +1 Query: 157 QHHRRAPDRSIAGAEVILGGLATAIFGAIFAYIRVTRKQSSTEDN 291 +HH+ D+S+AG VI+GGL TAIF A+F YIRVTRK++ + N Sbjct: 71 KHHQHHSDKSVAGGGVIIGGLVTAIFAAVFCYIRVTRKRNGADAN 115