BLASTX nr result
ID: Zingiber25_contig00028734
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00028734 (409 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004497502.1| PREDICTED: 60S ribosomal protein L12-like [C... 98 1e-18 ref|XP_003537293.1| PREDICTED: 60S ribosomal protein L12-like [G... 98 1e-18 ref|XP_006424575.1| hypothetical protein CICLE_v10029416mg [Citr... 97 2e-18 gb|ESW17210.1| hypothetical protein PHAVU_007G220300g [Phaseolus... 97 3e-18 gb|AFK45138.1| unknown [Medicago truncatula] 97 3e-18 ref|XP_004487110.1| PREDICTED: 60S ribosomal protein L12-like [C... 96 4e-18 ref|XP_003542515.1| PREDICTED: 60S ribosomal protein L12-like [G... 96 4e-18 ref|XP_002530279.1| 60S ribosomal protein L12, putative [Ricinus... 96 4e-18 ref|NP_001238575.1| uncharacterized protein LOC100527860 [Glycin... 96 7e-18 ref|XP_006481460.1| PREDICTED: 60S ribosomal protein L12-like [C... 95 1e-17 ref|XP_006428784.1| hypothetical protein CICLE_v10012805mg [Citr... 95 1e-17 ref|XP_006846773.1| hypothetical protein AMTR_s00148p00026900 [A... 95 1e-17 ref|XP_006837179.1| hypothetical protein AMTR_s00105p00048810 [A... 95 1e-17 ref|XP_004505994.1| PREDICTED: 60S ribosomal protein L12-3-like ... 95 1e-17 ref|XP_004291576.1| PREDICTED: 60S ribosomal protein L12-like [F... 95 1e-17 ref|XP_004250933.1| PREDICTED: 60S ribosomal protein L12-like [S... 95 1e-17 gb|ESW04252.1| hypothetical protein PHAVU_011G079400g [Phaseolus... 94 1e-17 ref|XP_003632111.1| PREDICTED: 60S ribosomal protein L12-like [V... 94 1e-17 ref|NP_001240945.1| uncharacterized protein LOC100811654 [Glycin... 94 1e-17 gb|EOY34360.1| Ribosomal protein L11 family protein [Theobroma c... 94 2e-17 >ref|XP_004497502.1| PREDICTED: 60S ribosomal protein L12-like [Cicer arietinum] Length = 166 Score = 98.2 bits (243), Expect = 1e-18 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -3 Query: 407 PRSMAKELSGTVKEILGTCVSVGCTVDGKDPKDLQQEISDGDVEVPLE 264 PRSMAKELSGTVKEILGTCVSVGCTVDGKDPKDLQQEI+DGDVE+PLE Sbjct: 119 PRSMAKELSGTVKEILGTCVSVGCTVDGKDPKDLQQEINDGDVEIPLE 166 >ref|XP_003537293.1| PREDICTED: 60S ribosomal protein L12-like [Glycine max] Length = 166 Score = 98.2 bits (243), Expect = 1e-18 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -3 Query: 407 PRSMAKELSGTVKEILGTCVSVGCTVDGKDPKDLQQEISDGDVEVPLE 264 PRSMAK+LSGT+KEILGTCVSVGCTVDGKDPKDLQQEISDGDVEVPLE Sbjct: 119 PRSMAKDLSGTIKEILGTCVSVGCTVDGKDPKDLQQEISDGDVEVPLE 166 >ref|XP_006424575.1| hypothetical protein CICLE_v10029416mg [Citrus clementina] gi|568869778|ref|XP_006488094.1| PREDICTED: 60S ribosomal protein L12-like [Citrus sinensis] gi|557526509|gb|ESR37815.1| hypothetical protein CICLE_v10029416mg [Citrus clementina] Length = 166 Score = 97.1 bits (240), Expect = 2e-18 Identities = 45/48 (93%), Positives = 48/48 (100%) Frame = -3 Query: 407 PRSMAKELSGTVKEILGTCVSVGCTVDGKDPKDLQQEISDGDVEVPLE 264 PRSMAKELSGTVKEILGTCVSVGCTVDGKDPKDLQQEI+DGDVE+PL+ Sbjct: 119 PRSMAKELSGTVKEILGTCVSVGCTVDGKDPKDLQQEINDGDVEIPLD 166 >gb|ESW17210.1| hypothetical protein PHAVU_007G220300g [Phaseolus vulgaris] Length = 203 Score = 96.7 bits (239), Expect = 3e-18 Identities = 45/48 (93%), Positives = 48/48 (100%) Frame = -3 Query: 407 PRSMAKELSGTVKEILGTCVSVGCTVDGKDPKDLQQEISDGDVEVPLE 264 PRSMAK+LSG++KEILGTCVSVGCTVDGKDPKDLQQEISDGDVEVPLE Sbjct: 156 PRSMAKDLSGSIKEILGTCVSVGCTVDGKDPKDLQQEISDGDVEVPLE 203 >gb|AFK45138.1| unknown [Medicago truncatula] Length = 166 Score = 96.7 bits (239), Expect = 3e-18 Identities = 45/48 (93%), Positives = 47/48 (97%) Frame = -3 Query: 407 PRSMAKELSGTVKEILGTCVSVGCTVDGKDPKDLQQEISDGDVEVPLE 264 PRSMAKEL+GTVKEILGTCVSVGCTVDGKDPKDLQQEI DGDVE+PLE Sbjct: 119 PRSMAKELAGTVKEILGTCVSVGCTVDGKDPKDLQQEIDDGDVEIPLE 166 >ref|XP_004487110.1| PREDICTED: 60S ribosomal protein L12-like [Cicer arietinum] Length = 166 Score = 96.3 bits (238), Expect = 4e-18 Identities = 45/47 (95%), Positives = 47/47 (100%) Frame = -3 Query: 407 PRSMAKELSGTVKEILGTCVSVGCTVDGKDPKDLQQEISDGDVEVPL 267 PRSMAKELSGTVKEILGTCVSVGCTVDGKDPKDLQQEI+DGDVE+PL Sbjct: 119 PRSMAKELSGTVKEILGTCVSVGCTVDGKDPKDLQQEINDGDVEIPL 165 >ref|XP_003542515.1| PREDICTED: 60S ribosomal protein L12-like [Glycine max] Length = 166 Score = 96.3 bits (238), Expect = 4e-18 Identities = 45/47 (95%), Positives = 47/47 (100%) Frame = -3 Query: 407 PRSMAKELSGTVKEILGTCVSVGCTVDGKDPKDLQQEISDGDVEVPL 267 PRSMAK+LSGT+KEILGTCVSVGCTVDGKDPKDLQQEISDGDVEVPL Sbjct: 119 PRSMAKDLSGTIKEILGTCVSVGCTVDGKDPKDLQQEISDGDVEVPL 165 >ref|XP_002530279.1| 60S ribosomal protein L12, putative [Ricinus communis] gi|223530177|gb|EEF32086.1| 60S ribosomal protein L12, putative [Ricinus communis] Length = 166 Score = 96.3 bits (238), Expect = 4e-18 Identities = 45/48 (93%), Positives = 48/48 (100%) Frame = -3 Query: 407 PRSMAKELSGTVKEILGTCVSVGCTVDGKDPKDLQQEISDGDVEVPLE 264 PRSMAK+LSGTVKEILGTCVSVGCTVDGKDPKDLQQEI+DGDVEVPL+ Sbjct: 119 PRSMAKDLSGTVKEILGTCVSVGCTVDGKDPKDLQQEITDGDVEVPLD 166 >ref|NP_001238575.1| uncharacterized protein LOC100527860 [Glycine max] gi|255633392|gb|ACU17053.1| unknown [Glycine max] Length = 166 Score = 95.5 bits (236), Expect = 7e-18 Identities = 44/48 (91%), Positives = 48/48 (100%) Frame = -3 Query: 407 PRSMAKELSGTVKEILGTCVSVGCTVDGKDPKDLQQEISDGDVEVPLE 264 PRSMAK+LSG++KEILGTCVSVGCTVDGKDPKDLQQEISDGDVEVPL+ Sbjct: 119 PRSMAKDLSGSIKEILGTCVSVGCTVDGKDPKDLQQEISDGDVEVPLD 166 >ref|XP_006481460.1| PREDICTED: 60S ribosomal protein L12-like [Citrus sinensis] Length = 166 Score = 94.7 bits (234), Expect = 1e-17 Identities = 43/48 (89%), Positives = 48/48 (100%) Frame = -3 Query: 407 PRSMAKELSGTVKEILGTCVSVGCTVDGKDPKDLQQEISDGDVEVPLE 264 PRSMAK+LSGTVKEILGTCVSVGCTVDGKDP+DLQQEI+DGDVE+PL+ Sbjct: 119 PRSMAKDLSGTVKEILGTCVSVGCTVDGKDPRDLQQEITDGDVEIPLD 166 >ref|XP_006428784.1| hypothetical protein CICLE_v10012805mg [Citrus clementina] gi|557530841|gb|ESR42024.1| hypothetical protein CICLE_v10012805mg [Citrus clementina] Length = 203 Score = 94.7 bits (234), Expect = 1e-17 Identities = 43/48 (89%), Positives = 48/48 (100%) Frame = -3 Query: 407 PRSMAKELSGTVKEILGTCVSVGCTVDGKDPKDLQQEISDGDVEVPLE 264 PRSMAK+LSGTVKEILGTCVSVGCTVDGKDP+DLQQEI+DGDVE+PL+ Sbjct: 156 PRSMAKDLSGTVKEILGTCVSVGCTVDGKDPRDLQQEITDGDVEIPLD 203 >ref|XP_006846773.1| hypothetical protein AMTR_s00148p00026900 [Amborella trichopoda] gi|548849595|gb|ERN08354.1| hypothetical protein AMTR_s00148p00026900 [Amborella trichopoda] Length = 166 Score = 94.7 bits (234), Expect = 1e-17 Identities = 44/48 (91%), Positives = 48/48 (100%) Frame = -3 Query: 407 PRSMAKELSGTVKEILGTCVSVGCTVDGKDPKDLQQEISDGDVEVPLE 264 PRSMAK+L+GTVKEILGTCVSVGCTVDGKDPKDLQ+EISDGDVEVPL+ Sbjct: 119 PRSMAKDLTGTVKEILGTCVSVGCTVDGKDPKDLQKEISDGDVEVPLD 166 >ref|XP_006837179.1| hypothetical protein AMTR_s00105p00048810 [Amborella trichopoda] gi|548839776|gb|ERN00033.1| hypothetical protein AMTR_s00105p00048810 [Amborella trichopoda] Length = 166 Score = 94.7 bits (234), Expect = 1e-17 Identities = 44/48 (91%), Positives = 48/48 (100%) Frame = -3 Query: 407 PRSMAKELSGTVKEILGTCVSVGCTVDGKDPKDLQQEISDGDVEVPLE 264 PRSMAK+LSGTVKEILGTCVSVGCTVDGKDPKDLQ+EI+DGDVEVPL+ Sbjct: 119 PRSMAKDLSGTVKEILGTCVSVGCTVDGKDPKDLQKEITDGDVEVPLD 166 >ref|XP_004505994.1| PREDICTED: 60S ribosomal protein L12-3-like [Cicer arietinum] Length = 166 Score = 94.7 bits (234), Expect = 1e-17 Identities = 44/46 (95%), Positives = 46/46 (100%) Frame = -3 Query: 407 PRSMAKELSGTVKEILGTCVSVGCTVDGKDPKDLQQEISDGDVEVP 270 PRSMAKELSGTVKEILGTCVSVGCTVDGKDPKDLQQEI+DGDVE+P Sbjct: 119 PRSMAKELSGTVKEILGTCVSVGCTVDGKDPKDLQQEINDGDVEIP 164 >ref|XP_004291576.1| PREDICTED: 60S ribosomal protein L12-like [Fragaria vesca subsp. vesca] Length = 166 Score = 94.7 bits (234), Expect = 1e-17 Identities = 45/47 (95%), Positives = 47/47 (100%) Frame = -3 Query: 404 RSMAKELSGTVKEILGTCVSVGCTVDGKDPKDLQQEISDGDVEVPLE 264 RSMAK+LSGTVKEILGTCVSVGCTVDGKDPKDLQQEISDGDVEVPL+ Sbjct: 120 RSMAKDLSGTVKEILGTCVSVGCTVDGKDPKDLQQEISDGDVEVPLD 166 >ref|XP_004250933.1| PREDICTED: 60S ribosomal protein L12-like [Solanum lycopersicum] gi|460411473|ref|XP_004251135.1| PREDICTED: 60S ribosomal protein L12-like [Solanum lycopersicum] Length = 166 Score = 94.7 bits (234), Expect = 1e-17 Identities = 44/46 (95%), Positives = 46/46 (100%) Frame = -3 Query: 407 PRSMAKELSGTVKEILGTCVSVGCTVDGKDPKDLQQEISDGDVEVP 270 PRSMAK+LSGTVKEILGTCVSVGCTVDGKDPKDLQQEISDGDVE+P Sbjct: 119 PRSMAKDLSGTVKEILGTCVSVGCTVDGKDPKDLQQEISDGDVEIP 164 >gb|ESW04252.1| hypothetical protein PHAVU_011G079400g [Phaseolus vulgaris] Length = 166 Score = 94.4 bits (233), Expect = 1e-17 Identities = 43/48 (89%), Positives = 48/48 (100%) Frame = -3 Query: 407 PRSMAKELSGTVKEILGTCVSVGCTVDGKDPKDLQQEISDGDVEVPLE 264 PRSMAK+LSG++KEILGTCVSVGCTVDGKDPKDLQQEI+DGDVEVPL+ Sbjct: 119 PRSMAKDLSGSIKEILGTCVSVGCTVDGKDPKDLQQEITDGDVEVPLD 166 >ref|XP_003632111.1| PREDICTED: 60S ribosomal protein L12-like [Vitis vinifera] Length = 166 Score = 94.4 bits (233), Expect = 1e-17 Identities = 43/48 (89%), Positives = 48/48 (100%) Frame = -3 Query: 407 PRSMAKELSGTVKEILGTCVSVGCTVDGKDPKDLQQEISDGDVEVPLE 264 PRSMAK+LSG+VKEILGTCVSVGCTVDGKDPKDLQQEI+DGDVE+PL+ Sbjct: 119 PRSMAKDLSGSVKEILGTCVSVGCTVDGKDPKDLQQEIADGDVEIPLD 166 >ref|NP_001240945.1| uncharacterized protein LOC100811654 [Glycine max] gi|255647178|gb|ACU24057.1| unknown [Glycine max] Length = 166 Score = 94.4 bits (233), Expect = 1e-17 Identities = 43/48 (89%), Positives = 48/48 (100%) Frame = -3 Query: 407 PRSMAKELSGTVKEILGTCVSVGCTVDGKDPKDLQQEISDGDVEVPLE 264 PRSMAK+LSG++KEILGTCVSVGCTVDGKDPKDLQQEI+DGDVEVPL+ Sbjct: 119 PRSMAKDLSGSIKEILGTCVSVGCTVDGKDPKDLQQEITDGDVEVPLD 166 >gb|EOY34360.1| Ribosomal protein L11 family protein [Theobroma cacao] Length = 166 Score = 94.0 bits (232), Expect = 2e-17 Identities = 44/48 (91%), Positives = 46/48 (95%) Frame = -3 Query: 407 PRSMAKELSGTVKEILGTCVSVGCTVDGKDPKDLQQEISDGDVEVPLE 264 PRSMAK+L GTVKEILGTCVSVGCTVDGKDPKDLQQEI DGDV+VPLE Sbjct: 119 PRSMAKDLRGTVKEILGTCVSVGCTVDGKDPKDLQQEIDDGDVDVPLE 166