BLASTX nr result
ID: Zingiber25_contig00028105
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00028105 (2296 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMT31506.1| Squamosa promoter-binding-like protein 5 [Aegilop... 40 3e-06 >gb|EMT31506.1| Squamosa promoter-binding-like protein 5 [Aegilops tauschii] Length = 379 Score = 39.7 bits (91), Expect(3) = 3e-06 Identities = 23/49 (46%), Positives = 29/49 (59%), Gaps = 6/49 (12%) Frame = +3 Query: 2043 LKREENG----VGATGRIGLNLGQRSYFSSG--VDAGHFIFRQKGNGSG 2171 LKREE G VG GRIGLNLG+R+YFS + + R + G+G Sbjct: 124 LKREEGGPFSDVGGGGRIGLNLGRRTYFSPADVLAVDRLLMRSRFGGAG 172 Score = 37.4 bits (85), Expect(3) = 3e-06 Identities = 14/19 (73%), Positives = 16/19 (84%) Frame = +2 Query: 2222 GCNSDLSSAKHYDRHHKVC 2278 GC +DLS+AKHY R HKVC Sbjct: 197 GCKADLSAAKHYHRRHKVC 215 Score = 22.3 bits (46), Expect(3) = 3e-06 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 2176 GHPATSHLPPHCQAEG 2223 G A H P CQAEG Sbjct: 182 GAAAHQHQTPRCQAEG 197