BLASTX nr result
ID: Zingiber25_contig00028087
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00028087 (696 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMT16302.1| hypothetical protein F775_04269 [Aegilops tauschii] 58 2e-06 gb|EMS54239.1| Kelch-like protein 1 [Triticum urartu] 58 2e-06 >gb|EMT16302.1| hypothetical protein F775_04269 [Aegilops tauschii] Length = 934 Score = 58.2 bits (139), Expect = 2e-06 Identities = 34/63 (53%), Positives = 42/63 (66%), Gaps = 1/63 (1%) Frame = +2 Query: 368 SLDKFTVSCLGPEHVIYL-SGYNDIF*LSTLRSFSPSLDILTFHKSTSCAHSYTFAVSMD 544 SL++F CLG E VIYL G++ I LS+L SFSPSLDILT K + SYT AV++D Sbjct: 577 SLNQFVEECLGSEDVIYLIGGFDGISFLSSLDSFSPSLDILTPLKPMTAGKSYTSAVALD 636 Query: 545 DNI 553 I Sbjct: 637 GKI 639 >gb|EMS54239.1| Kelch-like protein 1 [Triticum urartu] Length = 795 Score = 58.2 bits (139), Expect = 2e-06 Identities = 34/63 (53%), Positives = 42/63 (66%), Gaps = 1/63 (1%) Frame = +2 Query: 368 SLDKFTVSCLGPEHVIYL-SGYNDIF*LSTLRSFSPSLDILTFHKSTSCAHSYTFAVSMD 544 SL++F CLG E VIYL G++ I LS+L SFSPSLDILT K + SYT AV++D Sbjct: 498 SLNQFVEECLGSEDVIYLIGGFDGISFLSSLDSFSPSLDILTPLKPMTAGKSYTSAVALD 557 Query: 545 DNI 553 I Sbjct: 558 GKI 560