BLASTX nr result
ID: Zingiber25_contig00027964
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00027964 (422 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003870274.1| Gis2 transcription factor [Candida orthopsil... 55 7e-06 emb|CCE41356.1| hypothetical protein CPAR2_303450 [Candida parap... 55 7e-06 ref|XP_001524734.1| zinc-finger protein GIS2 [Lodderomyces elong... 55 7e-06 >ref|XP_003870274.1| Gis2 transcription factor [Candida orthopsilosis Co 90-125] gi|380354628|emb|CCG24144.1| Gis2 transcription factor [Candida orthopsilosis] Length = 177 Score = 55.5 bits (132), Expect = 7e-06 Identities = 17/44 (38%), Positives = 30/44 (68%) Frame = -1 Query: 197 CFRCGEHGHIVDDCSLDENICFFCKESGHVQDECPRKTKLNAKK 66 C++CGE GH+ DDC+ +E +C+ C++ GH +CP + +K+ Sbjct: 9 CYKCGEAGHVADDCTQEERLCYNCRKPGHESGDCPEPKQTTSKQ 52 >emb|CCE41356.1| hypothetical protein CPAR2_303450 [Candida parapsilosis] Length = 180 Score = 55.5 bits (132), Expect = 7e-06 Identities = 17/44 (38%), Positives = 30/44 (68%) Frame = -1 Query: 197 CFRCGEHGHIVDDCSLDENICFFCKESGHVQDECPRKTKLNAKK 66 C++CGE GH+ DDC+ +E +C+ C++ GH +CP + +K+ Sbjct: 9 CYKCGEAGHVADDCTQEERLCYNCRKPGHESGDCPEPKQATSKQ 52 >ref|XP_001524734.1| zinc-finger protein GIS2 [Lodderomyces elongisporus NRRL YB-4239] gi|146451331|gb|EDK45587.1| zinc-finger protein GIS2 [Lodderomyces elongisporus NRRL YB-4239] Length = 178 Score = 55.5 bits (132), Expect = 7e-06 Identities = 18/44 (40%), Positives = 30/44 (68%) Frame = -1 Query: 197 CFRCGEHGHIVDDCSLDENICFFCKESGHVQDECPRKTKLNAKK 66 C++CGE GH+ DDC+ +E +C+ C + GH +CP + N+K+ Sbjct: 9 CYKCGEVGHVADDCTQEERLCYNCHKPGHESGDCPDPKQTNSKQ 52