BLASTX nr result
ID: Zingiber25_contig00027751
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00027751 (438 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001056157.2| Os05g0535600 [Oryza sativa Japonica Group] g... 72 8e-11 gb|EEE64495.1| hypothetical protein OsJ_19345 [Oryza sativa Japo... 72 8e-11 gb|EEC79590.1| hypothetical protein OsI_20770 [Oryza sativa Indi... 72 8e-11 gb|AAT39210.1| putative inositol-1,4,5-trisphosphate phosphatase... 72 8e-11 gb|AAS75232.1| putative inositol-1,4,5-trisphosphate 5-phosphata... 72 8e-11 ref|XP_003565993.1| PREDICTED: type I inositol-1,4,5-trisphospha... 69 6e-10 ref|XP_006654705.1| PREDICTED: type I inositol 1,4,5-trisphospha... 69 8e-10 gb|EMJ02157.1| hypothetical protein PRUPE_ppa002431mg [Prunus pe... 68 1e-09 ref|XP_004170578.1| PREDICTED: type I inositol 1,4,5-trisphospha... 68 1e-09 ref|XP_004140952.1| PREDICTED: type I inositol 1,4,5-trisphospha... 68 1e-09 ref|XP_002524358.1| type I inositol polyphosphate 5-phosphatase,... 68 1e-09 ref|XP_006574785.1| PREDICTED: type I inositol 1,4,5-trisphospha... 67 2e-09 ref|XP_006574784.1| PREDICTED: type I inositol 1,4,5-trisphospha... 67 2e-09 dbj|BAK00154.1| predicted protein [Hordeum vulgare subsp. vulgare] 67 3e-09 gb|ESW23942.1| hypothetical protein PHAVU_004G0893000g [Phaseolu... 65 1e-08 gb|ESW23941.1| hypothetical protein PHAVU_004G0893000g [Phaseolu... 65 1e-08 ref|XP_004961387.1| PREDICTED: type I inositol 1,4,5-trisphospha... 65 1e-08 gb|EPS63949.1| inositol-1,4,5-triphosphate-5-phosphatase, partia... 64 2e-08 gb|EMT20216.1| Type I inositol-1,4,5-trisphosphate 5-phosphatase... 64 2e-08 ref|XP_006599468.1| PREDICTED: type I inositol 1,4,5-trisphospha... 64 2e-08 >ref|NP_001056157.2| Os05g0535600 [Oryza sativa Japonica Group] gi|255676526|dbj|BAF18071.2| Os05g0535600 [Oryza sativa Japonica Group] Length = 651 Score = 72.0 bits (175), Expect = 8e-11 Identities = 32/38 (84%), Positives = 36/38 (94%) Frame = -3 Query: 436 YKRAEIKLSDHRPVTAVFMAEVEVFCHRKLQRALTFTD 323 Y+R E+KLSDHRPVTAVFMA+VEV CHRKLQ+ALTFTD Sbjct: 601 YRRGELKLSDHRPVTAVFMADVEVLCHRKLQKALTFTD 638 >gb|EEE64495.1| hypothetical protein OsJ_19345 [Oryza sativa Japonica Group] Length = 671 Score = 72.0 bits (175), Expect = 8e-11 Identities = 32/38 (84%), Positives = 36/38 (94%) Frame = -3 Query: 436 YKRAEIKLSDHRPVTAVFMAEVEVFCHRKLQRALTFTD 323 Y+R E+KLSDHRPVTAVFMA+VEV CHRKLQ+ALTFTD Sbjct: 619 YRRGELKLSDHRPVTAVFMADVEVLCHRKLQKALTFTD 656 >gb|EEC79590.1| hypothetical protein OsI_20770 [Oryza sativa Indica Group] Length = 696 Score = 72.0 bits (175), Expect = 8e-11 Identities = 32/38 (84%), Positives = 36/38 (94%) Frame = -3 Query: 436 YKRAEIKLSDHRPVTAVFMAEVEVFCHRKLQRALTFTD 323 Y+R E+KLSDHRPVTAVFMA+VEV CHRKLQ+ALTFTD Sbjct: 644 YRRGELKLSDHRPVTAVFMADVEVLCHRKLQKALTFTD 681 >gb|AAT39210.1| putative inositol-1,4,5-trisphosphate phosphatase [Oryza sativa Japonica Group] Length = 569 Score = 72.0 bits (175), Expect = 8e-11 Identities = 32/38 (84%), Positives = 36/38 (94%) Frame = -3 Query: 436 YKRAEIKLSDHRPVTAVFMAEVEVFCHRKLQRALTFTD 323 Y+R E+KLSDHRPVTAVFMA+VEV CHRKLQ+ALTFTD Sbjct: 518 YRRGELKLSDHRPVTAVFMADVEVLCHRKLQKALTFTD 555 >gb|AAS75232.1| putative inositol-1,4,5-trisphosphate 5-phosphatase [Oryza sativa Japonica Group] Length = 590 Score = 72.0 bits (175), Expect = 8e-11 Identities = 32/38 (84%), Positives = 36/38 (94%) Frame = -3 Query: 436 YKRAEIKLSDHRPVTAVFMAEVEVFCHRKLQRALTFTD 323 Y+R E+KLSDHRPVTAVFMA+VEV CHRKLQ+ALTFTD Sbjct: 539 YRRGELKLSDHRPVTAVFMADVEVLCHRKLQKALTFTD 576 >ref|XP_003565993.1| PREDICTED: type I inositol-1,4,5-trisphosphate 5-phosphatase 1-like [Brachypodium distachyon] Length = 681 Score = 68.9 bits (167), Expect = 6e-10 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = -3 Query: 436 YKRAEIKLSDHRPVTAVFMAEVEVFCHRKLQRALTFTD 323 YKRAE+ LSDHRPV+AV+MAEVEV CHRKLQRALT TD Sbjct: 629 YKRAELDLSDHRPVSAVYMAEVEVICHRKLQRALTSTD 666 >ref|XP_006654705.1| PREDICTED: type I inositol 1,4,5-trisphosphate 5-phosphatase 1-like [Oryza brachyantha] Length = 617 Score = 68.6 bits (166), Expect = 8e-10 Identities = 30/38 (78%), Positives = 35/38 (92%) Frame = -3 Query: 436 YKRAEIKLSDHRPVTAVFMAEVEVFCHRKLQRALTFTD 323 Y+R E+KLSDHRPVTAV+ A+VEV CHRKLQ+ALTFTD Sbjct: 566 YRRGELKLSDHRPVTAVYTADVEVLCHRKLQKALTFTD 603 >gb|EMJ02157.1| hypothetical protein PRUPE_ppa002431mg [Prunus persica] Length = 673 Score = 68.2 bits (165), Expect = 1e-09 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = -3 Query: 436 YKRAEIKLSDHRPVTAVFMAEVEVFCHRKLQRALTFTD 323 Y+RAE+KLSDHRPVTA +MAEVEVF RKLQRALTFTD Sbjct: 588 YRRAELKLSDHRPVTATYMAEVEVFSSRKLQRALTFTD 625 >ref|XP_004170578.1| PREDICTED: type I inositol 1,4,5-trisphosphate 5-phosphatase 1-like, partial [Cucumis sativus] Length = 150 Score = 67.8 bits (164), Expect = 1e-09 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = -3 Query: 436 YKRAEIKLSDHRPVTAVFMAEVEVFCHRKLQRALTFTD 323 Y+R EIK SDHRPVTA ++AEVEVFC RKLQRALTFTD Sbjct: 100 YRRTEIKFSDHRPVTATYVAEVEVFCPRKLQRALTFTD 137 >ref|XP_004140952.1| PREDICTED: type I inositol 1,4,5-trisphosphate 5-phosphatase 1-like [Cucumis sativus] Length = 630 Score = 67.8 bits (164), Expect = 1e-09 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = -3 Query: 436 YKRAEIKLSDHRPVTAVFMAEVEVFCHRKLQRALTFTD 323 Y+R EIK SDHRPVTA ++AEVEVFC RKLQRALTFTD Sbjct: 580 YRRTEIKFSDHRPVTATYVAEVEVFCPRKLQRALTFTD 617 >ref|XP_002524358.1| type I inositol polyphosphate 5-phosphatase, putative [Ricinus communis] gi|223536449|gb|EEF38098.1| type I inositol polyphosphate 5-phosphatase, putative [Ricinus communis] Length = 575 Score = 67.8 bits (164), Expect = 1e-09 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = -3 Query: 436 YKRAEIKLSDHRPVTAVFMAEVEVFCHRKLQRALTFTD 323 Y R E+KLSDHRPV A +MAE EVFCHRKLQRALT+TD Sbjct: 504 YGRTELKLSDHRPVAATYMAEAEVFCHRKLQRALTYTD 541 >ref|XP_006574785.1| PREDICTED: type I inositol 1,4,5-trisphosphate 5-phosphatase 1-like isoform X2 [Glycine max] Length = 624 Score = 67.0 bits (162), Expect = 2e-09 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = -3 Query: 436 YKRAEIKLSDHRPVTAVFMAEVEVFCHRKLQRALTFTD 323 YKRAE+KLSDHRPVTA +M EVE+F RKLQRALTFTD Sbjct: 568 YKRAELKLSDHRPVTATYMVEVEIFSPRKLQRALTFTD 605 >ref|XP_006574784.1| PREDICTED: type I inositol 1,4,5-trisphosphate 5-phosphatase 1-like isoform X1 [Glycine max] Length = 639 Score = 67.0 bits (162), Expect = 2e-09 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = -3 Query: 436 YKRAEIKLSDHRPVTAVFMAEVEVFCHRKLQRALTFTD 323 YKRAE+KLSDHRPVTA +M EVE+F RKLQRALTFTD Sbjct: 583 YKRAELKLSDHRPVTATYMVEVEIFSPRKLQRALTFTD 620 >dbj|BAK00154.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 182 Score = 66.6 bits (161), Expect = 3e-09 Identities = 29/38 (76%), Positives = 35/38 (92%) Frame = -3 Query: 436 YKRAEIKLSDHRPVTAVFMAEVEVFCHRKLQRALTFTD 323 Y+RAE+ LSDHRPV+AV+MAEVEV CHRK Q+ALTFT+ Sbjct: 134 YRRAELNLSDHRPVSAVYMAEVEVLCHRKFQKALTFTN 171 >gb|ESW23942.1| hypothetical protein PHAVU_004G0893000g [Phaseolus vulgaris] Length = 632 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = -3 Query: 436 YKRAEIKLSDHRPVTAVFMAEVEVFCHRKLQRALTFTD 323 Y+RAE+KLSDHRPVTA +M EVE F RKLQRALTFTD Sbjct: 576 YRRAELKLSDHRPVTATYMVEVEAFSPRKLQRALTFTD 613 >gb|ESW23941.1| hypothetical protein PHAVU_004G0893000g [Phaseolus vulgaris] Length = 647 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = -3 Query: 436 YKRAEIKLSDHRPVTAVFMAEVEVFCHRKLQRALTFTD 323 Y+RAE+KLSDHRPVTA +M EVE F RKLQRALTFTD Sbjct: 591 YRRAELKLSDHRPVTATYMVEVEAFSPRKLQRALTFTD 628 >ref|XP_004961387.1| PREDICTED: type I inositol 1,4,5-trisphosphate 5-phosphatase 1-like [Setaria italica] Length = 488 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = -3 Query: 436 YKRAEIKLSDHRPVTAVFMAEVEVFCHRKLQRALTFTD 323 YKRAE+ SDHRPVTAV+MA+VEVF HRK +RALTFT+ Sbjct: 405 YKRAELTFSDHRPVTAVYMADVEVFVHRKFERALTFTN 442 >gb|EPS63949.1| inositol-1,4,5-triphosphate-5-phosphatase, partial [Genlisea aurea] Length = 576 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = -3 Query: 436 YKRAEIKLSDHRPVTAVFMAEVEVFCHRKLQRALTFTD 323 Y+R E+KLSDHRPVTA ++ EVEVFC +KLQR LTFTD Sbjct: 532 YRRTEVKLSDHRPVTAFYVVEVEVFCPKKLQRVLTFTD 569 >gb|EMT20216.1| Type I inositol-1,4,5-trisphosphate 5-phosphatase 1 [Aegilops tauschii] Length = 661 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = -3 Query: 436 YKRAEIKLSDHRPVTAVFMAEVEVFCHRKLQRALTFTD 323 Y+RAE+ LSDHRPV AV+M EVEV CHRK Q+ALTFT+ Sbjct: 613 YRRAELNLSDHRPVCAVYMTEVEVLCHRKFQKALTFTN 650 >ref|XP_006599468.1| PREDICTED: type I inositol 1,4,5-trisphosphate 5-phosphatase 1-like isoform X3 [Glycine max] gi|571528883|ref|XP_006599469.1| PREDICTED: type I inositol 1,4,5-trisphosphate 5-phosphatase 1-like isoform X4 [Glycine max] Length = 626 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = -3 Query: 436 YKRAEIKLSDHRPVTAVFMAEVEVFCHRKLQRALTFTD 323 Y+RAE+KLSDHRPVTA +M EVE F RKLQRALTFTD Sbjct: 570 YRRAELKLSDHRPVTAKYMVEVETFSPRKLQRALTFTD 607