BLASTX nr result
ID: Zingiber25_contig00027693
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00027693 (1008 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002464873.1| hypothetical protein SORBIDRAFT_01g027990 [S... 47 2e-09 >ref|XP_002464873.1| hypothetical protein SORBIDRAFT_01g027990 [Sorghum bicolor] gi|241918727|gb|EER91871.1| hypothetical protein SORBIDRAFT_01g027990 [Sorghum bicolor] Length = 319 Score = 47.4 bits (111), Expect(3) = 2e-09 Identities = 28/65 (43%), Positives = 30/65 (46%), Gaps = 6/65 (9%) Frame = +1 Query: 394 GFPYPPLLTPNFAXXXXXXXXXXXXXXXXXXXXXXXXXXWFPQSPSG------FLPILSP 555 GF +PP LTPNF WFPQSPSG FLPILSP Sbjct: 257 GFQHPPPLTPNFPALSPLPGTGILGPGPMPPPPSPGL--WFPQSPSGLLSPSGFLPILSP 314 Query: 556 RWRDM 570 RWRD+ Sbjct: 315 RWRDI 319 Score = 40.8 bits (94), Expect(3) = 2e-09 Identities = 19/27 (70%), Positives = 23/27 (85%) Frame = +1 Query: 106 PRPDGPSWAESPVSAYMRYLESSLLSS 186 P P GP+WA+SPVSAYMR LE+SL S+ Sbjct: 159 PAP-GPAWADSPVSAYMRILENSLFSA 184 Score = 20.8 bits (42), Expect(3) = 2e-09 Identities = 8/18 (44%), Positives = 9/18 (50%) Frame = +2 Query: 224 PPRGCFPPRAHPSPCLPP 277 PP P +HP P PP Sbjct: 208 PPHPHHPQPSHPHPPPPP 225