BLASTX nr result
ID: Zingiber25_contig00026999
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00026999 (332 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFW79963.1| hypothetical protein ZEAMMB73_998204 [Zea mays] 55 1e-05 >gb|AFW79963.1| hypothetical protein ZEAMMB73_998204 [Zea mays] Length = 269 Score = 55.1 bits (131), Expect = 1e-05 Identities = 36/81 (44%), Positives = 48/81 (59%), Gaps = 5/81 (6%) Frame = -3 Query: 297 GGILFHR-NPIVSAFAPPPHLFPDNPPASPTSGWVYFS--RDXXXXXXXXPFNGCVFPS- 130 GG L+ R NP+VSAF PPPHLF A+PTS WVYFS + CVFPS Sbjct: 121 GGALYPRANPMVSAFVPPPHLFGGGGDAAPTS-WVYFSPRAAAAGGQQFHVSHNCVFPSR 179 Query: 129 SSSSTRFPAVTPA-YNYSAAS 70 +++ A +PA ++Y++AS Sbjct: 180 AATPATVTAASPAVFSYASAS 200