BLASTX nr result
ID: Zingiber25_contig00026967
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00026967 (527 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAW34135.1| cysteine protease gp2b [Zingiber officinale] 60 3e-07 gb|AAW34134.1| cysteine protease gp2a [Zingiber officinale] 58 1e-06 >gb|AAW34135.1| cysteine protease gp2b [Zingiber officinale] Length = 379 Score = 60.1 bits (144), Expect = 3e-07 Identities = 30/36 (83%), Positives = 31/36 (86%) Frame = -2 Query: 526 RLRRSASGKISSRYRLREGDDLPDSID*RQKALSSP 419 RLRRSASGKISSRYRLREGDDLPDSID R+K P Sbjct: 121 RLRRSASGKISSRYRLREGDDLPDSIDWREKGAVVP 156 >gb|AAW34134.1| cysteine protease gp2a [Zingiber officinale] Length = 381 Score = 58.2 bits (139), Expect = 1e-06 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = -2 Query: 526 RLRRSASGKISSRYRLREGDDLPDSID*RQKALSSP 419 RLRRSASGKISSRYRLREGDDLPDSID R+ P Sbjct: 123 RLRRSASGKISSRYRLREGDDLPDSIDWRENGAVVP 158