BLASTX nr result
ID: Zingiber25_contig00026707
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00026707 (328 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001144081.1| uncharacterized protein LOC100276912 [Zea ma... 57 2e-06 ref|XP_004970822.1| PREDICTED: uncharacterized protein LOC101770... 55 1e-05 >ref|NP_001144081.1| uncharacterized protein LOC100276912 [Zea mays] gi|195636626|gb|ACG37781.1| hypothetical protein [Zea mays] Length = 396 Score = 57.4 bits (137), Expect = 2e-06 Identities = 36/61 (59%), Positives = 42/61 (68%), Gaps = 6/61 (9%) Frame = +3 Query: 3 DVSTKPGSISFRTMIMDD---LPGSDEISLS--VPLQIGSPSGSS-TPLRHILPLREIPR 164 D STKPGSISFRTMI +D G+DEI S + IGSPSGSS + +LPL+EIPR Sbjct: 336 DTSTKPGSISFRTMIREDQLQQDGTDEIGFSSRSGVHIGSPSGSSPSAAVPMLPLKEIPR 395 Query: 165 Y 167 Y Sbjct: 396 Y 396 >ref|XP_004970822.1| PREDICTED: uncharacterized protein LOC101770182 [Setaria italica] Length = 396 Score = 55.1 bits (131), Expect = 1e-05 Identities = 34/61 (55%), Positives = 42/61 (68%), Gaps = 6/61 (9%) Frame = +3 Query: 3 DVSTKPGSISFRTMIMDD---LPGSDEISLS--VPLQIGSPSGSS-TPLRHILPLREIPR 164 D STK GSISFRTMI +D G+DE+ S +QIGSPSGSS + +LPL+E+PR Sbjct: 336 DTSTKRGSISFRTMIREDQLQQDGADEMGFSSRSGVQIGSPSGSSPSAAMPMLPLKEVPR 395 Query: 165 Y 167 Y Sbjct: 396 Y 396