BLASTX nr result
ID: Zingiber25_contig00026613
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00026613 (343 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMS67637.1| Neurofilament heavy polypeptide [Triticum urartu] 81 2e-13 gb|AGE46115.1| arginine/serine-rich splicing factor RS2Z34 trans... 63 4e-08 gb|AGE46057.1| arginine/serine-rich splicing factor RS2Z35 trans... 39 2e-06 gb|AGE46053.1| arginine/serine-rich splicing factor RS2Z37B tran... 45 4e-06 >gb|EMS67637.1| Neurofilament heavy polypeptide [Triticum urartu] Length = 431 Score = 80.9 bits (198), Expect = 2e-13 Identities = 57/137 (41%), Positives = 66/137 (48%), Gaps = 23/137 (16%) Frame = -1 Query: 343 VGRISHRTRARDLEDLFGRYGR------FLGFL------------AQPGGL----WWEGA 230 VGR+ RTR RDLEDLFGRYGR FL A P + WWEGA Sbjct: 43 VGRLPSRTRTRDLEDLFGRYGRAEIETHLFNFLHPMALVIDMVLGAYPTSVSMVDWWEGA 102 Query: 229 IGGFGVYPSKFIGDFGDSFSNVIDVC*WKSSPSGV*LIF*GLK*CTFQYLSPDGL-LSGN 53 +GG G Y KFI L+ TF YL DG+ +SGN Sbjct: 103 LGGIGGYSRKFI-----------------------------LRGDTFLYLRLDGVTVSGN 133 Query: 52 NFRRVRNVDMKHDFAFV 2 +F RVR+VDMKH+FAFV Sbjct: 134 HFHRVRHVDMKHEFAFV 150 >gb|AGE46115.1| arginine/serine-rich splicing factor RS2Z34 transcript II [Sorghum bicolor] gi|448878306|gb|AGE46116.1| arginine/serine-rich splicing factor RS2Z34 transcript III [Sorghum bicolor] gi|448878308|gb|AGE46117.1| arginine/serine-rich splicing factor RS2Z34 transcript IV [Sorghum bicolor] Length = 94 Score = 63.2 bits (152), Expect = 4e-08 Identities = 30/40 (75%), Positives = 32/40 (80%) Frame = -1 Query: 343 VGRISHRTRARDLEDLFGRYGRFLGFLAQPGGLWWEGAIG 224 VGR+S RTR RDLEDLFGRYGRF G L QP WWEGA+G Sbjct: 28 VGRVSSRTRTRDLEDLFGRYGRFWG-LTQPRCPWWEGALG 66 >gb|AGE46057.1| arginine/serine-rich splicing factor RS2Z35 transcript II [Zea mays] Length = 73 Score = 39.3 bits (90), Expect(2) = 2e-06 Identities = 17/25 (68%), Positives = 22/25 (88%) Frame = -2 Query: 276 FWVFWPNLEVFGGRVPLVDLVSILP 202 F VF+P +EV GGRVPLV+LV+I+P Sbjct: 37 FSVFYPTMEVCGGRVPLVELVAIVP 61 Score = 37.7 bits (86), Expect(2) = 2e-06 Identities = 17/26 (65%), Positives = 21/26 (80%) Frame = -1 Query: 343 VGRISHRTRARDLEDLFGRYGRFLGF 266 VGR++ RTR+RDLE LF +YGRF F Sbjct: 15 VGRLAPRTRSRDLEYLFSKYGRFSVF 40 >gb|AGE46053.1| arginine/serine-rich splicing factor RS2Z37B transcript II [Zea mays] gi|448878182|gb|AGE46054.1| arginine/serine-rich splicing factor RS2Z37B transcript III [Zea mays] Length = 58 Score = 44.7 bits (104), Expect(2) = 4e-06 Identities = 20/32 (62%), Positives = 25/32 (78%) Frame = -1 Query: 343 VGRISHRTRARDLEDLFGRYGRFLGFLAQPGG 248 VGR++ RTR+RDLE LFG+YGRF GF + G Sbjct: 15 VGRLAPRTRSRDLEYLFGKYGRFFGFYREVFG 46 Score = 31.6 bits (70), Expect(2) = 4e-06 Identities = 14/15 (93%), Positives = 15/15 (100%) Frame = -2 Query: 252 EVFGGRVPLVDLVSI 208 EVFGGRVPLVDLV+I Sbjct: 43 EVFGGRVPLVDLVTI 57