BLASTX nr result
ID: Zingiber25_contig00026487
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00026487 (557 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ16943.1| hypothetical protein PRUPE_ppa009187mg [Prunus pe... 55 9e-06 >gb|EMJ16943.1| hypothetical protein PRUPE_ppa009187mg [Prunus persica] Length = 303 Score = 55.5 bits (132), Expect = 9e-06 Identities = 27/59 (45%), Positives = 37/59 (62%), Gaps = 4/59 (6%) Frame = +3 Query: 3 QSQIEVLTTPYLSSTSGNMKQ----PPTESTVEDLRSRGLCLMPISFILHVGRDFEGSY 167 Q QIE L++PYL + S NM+ P ++ +DLRS+GLCL+P+S HVG D Y Sbjct: 236 QGQIEALSSPYLGNASKNMRNQQSHPSSQDKAKDLRSKGLCLVPVSCTQHVGSDNGADY 294