BLASTX nr result
ID: Zingiber25_contig00026297
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00026297 (323 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002283006.1| PREDICTED: protein DCL, chloroplastic [Vitis... 104 5e-21 ref|NP_190247.1| uncharacterized protein [Arabidopsis thaliana] ... 103 2e-20 ref|XP_002877497.1| hypothetical protein ARALYDRAFT_905861 [Arab... 103 2e-20 gb|EOY14369.1| Uncharacterized protein TCM_033766 [Theobroma cacao] 103 3e-20 ref|XP_006418877.1| hypothetical protein EUTSA_v10002669mg [Eutr... 102 4e-20 ref|XP_006473271.1| PREDICTED: protein DCL, chloroplastic-like [... 101 9e-20 gb|EMJ27722.1| hypothetical protein PRUPE_ppa024709mg, partial [... 100 3e-19 ref|XP_002326952.1| predicted protein [Populus trichocarpa] 100 3e-19 ref|XP_006434703.1| hypothetical protein CICLE_v10002565mg [Citr... 99 6e-19 ref|XP_004501552.1| PREDICTED: protein DCL, chloroplastic-like [... 99 6e-19 ref|XP_002510162.1| conserved hypothetical protein [Ricinus comm... 99 8e-19 gb|ESW08704.1| hypothetical protein PHAVU_009G067500g [Phaseolus... 97 2e-18 ref|XP_003523609.1| PREDICTED: protein DCL, chloroplastic-like [... 97 2e-18 ref|XP_004291069.1| PREDICTED: protein DCL, chloroplastic-like [... 97 2e-18 ref|XP_006659296.1| PREDICTED: protein DCL, chloroplastic-like [... 95 1e-17 ref|XP_006855235.1| hypothetical protein AMTR_s00051p00224060 [A... 94 1e-17 ref|XP_006354844.1| PREDICTED: protein DCL, chloroplastic-like [... 94 2e-17 ref|XP_004238128.1| PREDICTED: protein DCL, chloroplastic-like [... 94 2e-17 gb|AAQ56405.1| putative defective chloroplasts and leaves (DCL) ... 94 2e-17 ref|XP_002466454.1| hypothetical protein SORBIDRAFT_01g008000 [S... 94 2e-17 >ref|XP_002283006.1| PREDICTED: protein DCL, chloroplastic [Vitis vinifera] gi|302142270|emb|CBI19473.3| unnamed protein product [Vitis vinifera] Length = 194 Score = 104 bits (260), Expect(2) = 5e-21 Identities = 47/55 (85%), Positives = 49/55 (89%) Frame = +2 Query: 35 VDRHPQFKHSRCLFVVRTDGGWIDFSYQKCLRAYIRDKYPLHAERFIAVRVTLSS 199 VDRHPQF+HSRCLFVVRTDGGWIDFSYQKCLRAYIRDKYP HA+RFI V SS Sbjct: 139 VDRHPQFRHSRCLFVVRTDGGWIDFSYQKCLRAYIRDKYPSHADRFIRVHFKRSS 193 Score = 21.9 bits (45), Expect(2) = 5e-21 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +3 Query: 6 LTKHILHSDR 35 LTK ILHSDR Sbjct: 91 LTKEILHSDR 100 >ref|NP_190247.1| uncharacterized protein [Arabidopsis thaliana] gi|6523066|emb|CAB62333.1| putative protein [Arabidopsis thaliana] gi|21554240|gb|AAM63315.1| unknown [Arabidopsis thaliana] gi|26452933|dbj|BAC43543.1| unknown protein [Arabidopsis thaliana] gi|28973177|gb|AAO63913.1| unknown protein [Arabidopsis thaliana] gi|332644664|gb|AEE78185.1| uncharacterized protein AT3G46630 [Arabidopsis thaliana] Length = 207 Score = 103 bits (258), Expect = 2e-20 Identities = 45/50 (90%), Positives = 47/50 (94%) Frame = +2 Query: 26 FRQVDRHPQFKHSRCLFVVRTDGGWIDFSYQKCLRAYIRDKYPLHAERFI 175 F VDRHPQF+HSRCLFVVRTDGGWIDFSYQKCLRAY+RDKYP HAERFI Sbjct: 149 FIMVDRHPQFRHSRCLFVVRTDGGWIDFSYQKCLRAYVRDKYPSHAERFI 198 >ref|XP_002877497.1| hypothetical protein ARALYDRAFT_905861 [Arabidopsis lyrata subsp. lyrata] gi|297323335|gb|EFH53756.1| hypothetical protein ARALYDRAFT_905861 [Arabidopsis lyrata subsp. lyrata] Length = 203 Score = 103 bits (258), Expect = 2e-20 Identities = 45/50 (90%), Positives = 47/50 (94%) Frame = +2 Query: 26 FRQVDRHPQFKHSRCLFVVRTDGGWIDFSYQKCLRAYIRDKYPLHAERFI 175 F VDRHPQF+HSRCLFVVRTDGGWIDFSYQKCLRAY+RDKYP HAERFI Sbjct: 145 FIMVDRHPQFRHSRCLFVVRTDGGWIDFSYQKCLRAYVRDKYPSHAERFI 194 >gb|EOY14369.1| Uncharacterized protein TCM_033766 [Theobroma cacao] Length = 197 Score = 103 bits (256), Expect = 3e-20 Identities = 45/47 (95%), Positives = 46/47 (97%) Frame = +2 Query: 35 VDRHPQFKHSRCLFVVRTDGGWIDFSYQKCLRAYIRDKYPLHAERFI 175 VDRHPQF+HSRCLFVVRTDGGWIDFSYQKCLRAYIRDKYP HAERFI Sbjct: 142 VDRHPQFRHSRCLFVVRTDGGWIDFSYQKCLRAYIRDKYPSHAERFI 188 >ref|XP_006418877.1| hypothetical protein EUTSA_v10002669mg [Eutrema salsugineum] gi|557096805|gb|ESQ37313.1| hypothetical protein EUTSA_v10002669mg [Eutrema salsugineum] Length = 202 Score = 102 bits (255), Expect = 4e-20 Identities = 44/50 (88%), Positives = 47/50 (94%) Frame = +2 Query: 26 FRQVDRHPQFKHSRCLFVVRTDGGWIDFSYQKCLRAYIRDKYPLHAERFI 175 F VDRHPQF+HSRCLFVVRTDGGWIDFSYQKCLRAY+RD+YP HAERFI Sbjct: 144 FIMVDRHPQFRHSRCLFVVRTDGGWIDFSYQKCLRAYVRDRYPSHAERFI 193 >ref|XP_006473271.1| PREDICTED: protein DCL, chloroplastic-like [Citrus sinensis] Length = 194 Score = 101 bits (252), Expect = 9e-20 Identities = 45/47 (95%), Positives = 45/47 (95%) Frame = +2 Query: 35 VDRHPQFKHSRCLFVVRTDGGWIDFSYQKCLRAYIRDKYPLHAERFI 175 VDRHPQF HSRCLFVVRTDGGWIDFSYQKCLRAYIRDKYP HAERFI Sbjct: 139 VDRHPQFGHSRCLFVVRTDGGWIDFSYQKCLRAYIRDKYPSHAERFI 185 >gb|EMJ27722.1| hypothetical protein PRUPE_ppa024709mg, partial [Prunus persica] Length = 146 Score = 99.8 bits (247), Expect = 3e-19 Identities = 47/65 (72%), Positives = 50/65 (76%), Gaps = 8/65 (12%) Frame = +2 Query: 5 AHQAHSPFR--------QVDRHPQFKHSRCLFVVRTDGGWIDFSYQKCLRAYIRDKYPLH 160 AH HS + VDRHPQF+HSRCLFV+RTDG WIDFSYQKCLRAYIRDKYP H Sbjct: 73 AHHPHSEDKIGCGIDSIMVDRHPQFRHSRCLFVIRTDGIWIDFSYQKCLRAYIRDKYPSH 132 Query: 161 AERFI 175 AERFI Sbjct: 133 AERFI 137 >ref|XP_002326952.1| predicted protein [Populus trichocarpa] Length = 195 Score = 99.8 bits (247), Expect = 3e-19 Identities = 44/47 (93%), Positives = 45/47 (95%) Frame = +2 Query: 35 VDRHPQFKHSRCLFVVRTDGGWIDFSYQKCLRAYIRDKYPLHAERFI 175 VDRHPQFK+SRCLFVVRTDGGWIDFSYQKCLRAYIR KYP HAERFI Sbjct: 141 VDRHPQFKNSRCLFVVRTDGGWIDFSYQKCLRAYIRSKYPTHAERFI 187 >ref|XP_006434703.1| hypothetical protein CICLE_v10002565mg [Citrus clementina] gi|557536825|gb|ESR47943.1| hypothetical protein CICLE_v10002565mg [Citrus clementina] Length = 194 Score = 99.0 bits (245), Expect = 6e-19 Identities = 44/47 (93%), Positives = 45/47 (95%) Frame = +2 Query: 35 VDRHPQFKHSRCLFVVRTDGGWIDFSYQKCLRAYIRDKYPLHAERFI 175 VDRHPQF +SRCLFVVRTDGGWIDFSYQKCLRAYIRDKYP HAERFI Sbjct: 139 VDRHPQFGNSRCLFVVRTDGGWIDFSYQKCLRAYIRDKYPSHAERFI 185 >ref|XP_004501552.1| PREDICTED: protein DCL, chloroplastic-like [Cicer arietinum] Length = 194 Score = 99.0 bits (245), Expect = 6e-19 Identities = 42/47 (89%), Positives = 45/47 (95%) Frame = +2 Query: 35 VDRHPQFKHSRCLFVVRTDGGWIDFSYQKCLRAYIRDKYPLHAERFI 175 VDRHPQF+HSRCLFVVRTDGGWIDFSYQKCLR YIR+KYP HAE+FI Sbjct: 139 VDRHPQFRHSRCLFVVRTDGGWIDFSYQKCLREYIREKYPTHAEKFI 185 >ref|XP_002510162.1| conserved hypothetical protein [Ricinus communis] gi|223550863|gb|EEF52349.1| conserved hypothetical protein [Ricinus communis] Length = 234 Score = 98.6 bits (244), Expect = 8e-19 Identities = 43/47 (91%), Positives = 44/47 (93%) Frame = +2 Query: 35 VDRHPQFKHSRCLFVVRTDGGWIDFSYQKCLRAYIRDKYPLHAERFI 175 VDRHPQF+HSRCLFVVR DGGWIDFSYQKCLRAYIR KYP HAERFI Sbjct: 180 VDRHPQFRHSRCLFVVRIDGGWIDFSYQKCLRAYIRHKYPAHAERFI 226 >gb|ESW08704.1| hypothetical protein PHAVU_009G067500g [Phaseolus vulgaris] Length = 203 Score = 97.4 bits (241), Expect = 2e-18 Identities = 42/47 (89%), Positives = 44/47 (93%) Frame = +2 Query: 35 VDRHPQFKHSRCLFVVRTDGGWIDFSYQKCLRAYIRDKYPLHAERFI 175 VDRHPQ++ SRCLFVVRTDGGWIDFSYQKCLR YIRDKYP HAERFI Sbjct: 148 VDRHPQYRQSRCLFVVRTDGGWIDFSYQKCLREYIRDKYPTHAERFI 194 >ref|XP_003523609.1| PREDICTED: protein DCL, chloroplastic-like [Glycine max] Length = 203 Score = 97.4 bits (241), Expect = 2e-18 Identities = 42/47 (89%), Positives = 44/47 (93%) Frame = +2 Query: 35 VDRHPQFKHSRCLFVVRTDGGWIDFSYQKCLRAYIRDKYPLHAERFI 175 VDRHPQ++ SRCLFVVRTDGGWIDFSYQKCLR YIRDKYP HAERFI Sbjct: 148 VDRHPQYRQSRCLFVVRTDGGWIDFSYQKCLREYIRDKYPTHAERFI 194 >ref|XP_004291069.1| PREDICTED: protein DCL, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 202 Score = 97.1 bits (240), Expect = 2e-18 Identities = 42/47 (89%), Positives = 44/47 (93%) Frame = +2 Query: 35 VDRHPQFKHSRCLFVVRTDGGWIDFSYQKCLRAYIRDKYPLHAERFI 175 VDRHPQFK SRCLFV+RT+G WIDFSYQKCLRAYIRDKYP HAERFI Sbjct: 147 VDRHPQFKQSRCLFVIRTNGAWIDFSYQKCLRAYIRDKYPTHAERFI 193 >ref|XP_006659296.1| PREDICTED: protein DCL, chloroplastic-like [Oryza brachyantha] Length = 185 Score = 94.7 bits (234), Expect = 1e-17 Identities = 42/47 (89%), Positives = 44/47 (93%) Frame = +2 Query: 35 VDRHPQFKHSRCLFVVRTDGGWIDFSYQKCLRAYIRDKYPLHAERFI 175 VDRHPQF+ SRCLFVVRTDG WIDFSYQKCLRAYIR+KYP HAERFI Sbjct: 132 VDRHPQFRKSRCLFVVRTDGVWIDFSYQKCLRAYIREKYPSHAERFI 178 >ref|XP_006855235.1| hypothetical protein AMTR_s00051p00224060 [Amborella trichopoda] gi|548858988|gb|ERN16702.1| hypothetical protein AMTR_s00051p00224060 [Amborella trichopoda] Length = 204 Score = 94.4 bits (233), Expect = 1e-17 Identities = 41/47 (87%), Positives = 45/47 (95%) Frame = +2 Query: 35 VDRHPQFKHSRCLFVVRTDGGWIDFSYQKCLRAYIRDKYPLHAERFI 175 VDRHPQF++SRCLFVVRTDGGWIDFSYQKCLRAYIR KYP +AE+FI Sbjct: 150 VDRHPQFRNSRCLFVVRTDGGWIDFSYQKCLRAYIRKKYPSYAEKFI 196 >ref|XP_006354844.1| PREDICTED: protein DCL, chloroplastic-like [Solanum tuberosum] Length = 197 Score = 93.6 bits (231), Expect = 2e-17 Identities = 41/47 (87%), Positives = 43/47 (91%) Frame = +2 Query: 35 VDRHPQFKHSRCLFVVRTDGGWIDFSYQKCLRAYIRDKYPLHAERFI 175 VDRHPQFK SRCLFVVR DGGWIDFSYQKCLR YIRDKYP +AE+FI Sbjct: 143 VDRHPQFKRSRCLFVVRLDGGWIDFSYQKCLRQYIRDKYPSYAEKFI 189 >ref|XP_004238128.1| PREDICTED: protein DCL, chloroplastic-like [Solanum lycopersicum] Length = 197 Score = 93.6 bits (231), Expect = 2e-17 Identities = 41/47 (87%), Positives = 43/47 (91%) Frame = +2 Query: 35 VDRHPQFKHSRCLFVVRTDGGWIDFSYQKCLRAYIRDKYPLHAERFI 175 VDRHPQFK SRCLFVVR DGGWIDFSYQKCLR YIRDKYP +AE+FI Sbjct: 143 VDRHPQFKRSRCLFVVRLDGGWIDFSYQKCLRQYIRDKYPSYAEKFI 189 >gb|AAQ56405.1| putative defective chloroplasts and leaves (DCL) protein [Oryza sativa Japonica Group] gi|50508259|dbj|BAD32070.1| putative DCL protein precursor [Oryza sativa Japonica Group] Length = 192 Score = 93.6 bits (231), Expect = 2e-17 Identities = 41/47 (87%), Positives = 44/47 (93%) Frame = +2 Query: 35 VDRHPQFKHSRCLFVVRTDGGWIDFSYQKCLRAYIRDKYPLHAERFI 175 VD+HPQF+ SRCLFVVRTDG WIDFSYQKCLRAYIR+KYP HAERFI Sbjct: 139 VDKHPQFRKSRCLFVVRTDGVWIDFSYQKCLRAYIREKYPSHAERFI 185 >ref|XP_002466454.1| hypothetical protein SORBIDRAFT_01g008000 [Sorghum bicolor] gi|241920308|gb|EER93452.1| hypothetical protein SORBIDRAFT_01g008000 [Sorghum bicolor] Length = 188 Score = 93.6 bits (231), Expect = 2e-17 Identities = 41/47 (87%), Positives = 44/47 (93%) Frame = +2 Query: 35 VDRHPQFKHSRCLFVVRTDGGWIDFSYQKCLRAYIRDKYPLHAERFI 175 VDRHP+F+ SRCLFVVRTDG WIDFSYQKCLRAYIR+KYP HAERFI Sbjct: 135 VDRHPEFRKSRCLFVVRTDGVWIDFSYQKCLRAYIREKYPSHAERFI 181