BLASTX nr result
ID: Zingiber25_contig00026194
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00026194 (394 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004148382.1| PREDICTED: GATA transcription factor 26-like... 56 4e-06 >ref|XP_004148382.1| PREDICTED: GATA transcription factor 26-like [Cucumis sativus] gi|449517838|ref|XP_004165951.1| PREDICTED: GATA transcription factor 26-like [Cucumis sativus] Length = 541 Score = 56.2 bits (134), Expect = 4e-06 Identities = 39/124 (31%), Positives = 65/124 (52%), Gaps = 5/124 (4%) Frame = -1 Query: 394 HNCSDIKTPVKSTKRVCRPELMNPPPSLSANQLESSAVSKVTDDANKFLDDEDCCFSPRR 215 H + + + + K++C N P + + + V K D +++ CFSPR Sbjct: 417 HANASVSSNFTNVKQLCESYNQNIPEAKTILKSPKRLVMKENKDPG---ENDGSCFSPRS 473 Query: 214 LFASLPDRNSML-----FIVDSTEDNLLLNVPSSSASFPEAQLLCHHPWEQKMNRNSSTK 50 LFA PD +S++ F+ +S++ +LLL+V S+S SFP+A+LL HP + R +ST Sbjct: 474 LFALPPDGSSLMLESLHFVEESSDQDLLLDVRSNS-SFPQAELL--HPTSRSGGRQASTC 530 Query: 49 EGGV 38 V Sbjct: 531 SSSV 534