BLASTX nr result
ID: Zingiber25_contig00025846
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00025846 (624 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006829061.1| hypothetical protein AMTR_s00001p00257920 [A... 56 9e-06 >ref|XP_006829061.1| hypothetical protein AMTR_s00001p00257920 [Amborella trichopoda] gi|548834040|gb|ERM96477.1| hypothetical protein AMTR_s00001p00257920 [Amborella trichopoda] Length = 105 Score = 55.8 bits (133), Expect = 9e-06 Identities = 31/86 (36%), Positives = 46/86 (53%), Gaps = 16/86 (18%) Frame = +2 Query: 152 MRVLKKLPVKSILEHVYPMKGTQRTVKIATLDKHGEEHL----------------VPIVA 283 MR+ KLP+K++L+ YP + + V ++ +HG E L P++A Sbjct: 19 MRMATKLPIKNVLKKCYPTRTWEALVAPSSGRQHGSEQLGRGPVTNDKAPLQDDKYPVIA 78 Query: 284 VDKPRLPPELGPLIVLSFLEMSSSND 361 KP LPP LGPL+VLS L +SS + Sbjct: 79 FSKPPLPPFLGPLLVLSLLNTNSSKE 104