BLASTX nr result
ID: Zingiber25_contig00025042
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00025042 (570 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGB52036.1| putative zinc finger transcription factor, partia... 67 2e-09 >gb|AGB52036.1| putative zinc finger transcription factor, partial [Elaeis guineensis] Length = 605 Score = 67.4 bits (163), Expect = 2e-09 Identities = 42/67 (62%), Positives = 46/67 (68%), Gaps = 1/67 (1%) Frame = +1 Query: 1 DEPDLSWVQSLVKDAPMAPIGQRLSAAGGEQQ-NGYQLSTGGEQQNGYELSTGGDVFSPW 177 DEPDLSWVQSLVKD P APIG+R G EQQ GY+L+ GG +G EL FSPW Sbjct: 550 DEPDLSWVQSLVKDGPAAPIGRR----GLEQQRKGYKLNGGGGDFHGSEL------FSPW 599 Query: 178 AEEKIMA 198 EEKIMA Sbjct: 600 -EEKIMA 605