BLASTX nr result
ID: Zingiber25_contig00024471
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00024471 (263 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAA85451.1| S-locus protein 2 [Brassica rapa] 55 7e-06 ref|XP_006391412.1| hypothetical protein EUTSA_v10018911mg [Eutr... 55 7e-06 ref|XP_006391411.1| hypothetical protein EUTSA_v10018911mg [Eutr... 55 7e-06 ref|XP_006302582.1| hypothetical protein CARUB_v10020690mg [Caps... 55 7e-06 gb|AAC35489.1| clp protease [Arabidopsis thaliana] 55 7e-06 ref|NP_564880.1| ATP-dependent Clp protease proteolytic subunit ... 55 7e-06 ref|XP_002888528.1| hypothetical protein ARALYDRAFT_894344 [Arab... 55 7e-06 ref|XP_002532641.1| ATP-dependent Clp protease proteolytic subun... 55 7e-06 emb|CAB89185.1| ClpP [Brassica napus var. napus] 55 7e-06 emb|CAC80640.1| ClpP putative protein [Brassica napus] 55 7e-06 gb|AAK48955.1|AF370528_1 ATP-dependent Clp protease; nClpP3 [Ara... 55 7e-06 gb|AAL34333.1|L41144_1 ClpP [Brassica oleracea] 55 7e-06 >dbj|BAA85451.1| S-locus protein 2 [Brassica rapa] Length = 311 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +2 Query: 176 RMPSFEQLDTTNMLLRQRIVFLGSQVDTM 262 R+PSFE+LDTTNMLLRQRIVFLGSQVD M Sbjct: 79 RLPSFEELDTTNMLLRQRIVFLGSQVDDM 107 >ref|XP_006391412.1| hypothetical protein EUTSA_v10018911mg [Eutrema salsugineum] gi|557087846|gb|ESQ28698.1| hypothetical protein EUTSA_v10018911mg [Eutrema salsugineum] Length = 311 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +2 Query: 176 RMPSFEQLDTTNMLLRQRIVFLGSQVDTM 262 R+PSFE+LDTTNMLLRQRIVFLGSQVD M Sbjct: 79 RLPSFEELDTTNMLLRQRIVFLGSQVDDM 107 >ref|XP_006391411.1| hypothetical protein EUTSA_v10018911mg [Eutrema salsugineum] gi|557087845|gb|ESQ28697.1| hypothetical protein EUTSA_v10018911mg [Eutrema salsugineum] Length = 242 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +2 Query: 176 RMPSFEQLDTTNMLLRQRIVFLGSQVDTM 262 R+PSFE+LDTTNMLLRQRIVFLGSQVD M Sbjct: 79 RLPSFEELDTTNMLLRQRIVFLGSQVDDM 107 >ref|XP_006302582.1| hypothetical protein CARUB_v10020690mg [Capsella rubella] gi|482571292|gb|EOA35480.1| hypothetical protein CARUB_v10020690mg [Capsella rubella] Length = 311 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +2 Query: 176 RMPSFEQLDTTNMLLRQRIVFLGSQVDTM 262 R+PSFE+LDTTNMLLRQRIVFLGSQVD M Sbjct: 79 RLPSFEELDTTNMLLRQRIVFLGSQVDDM 107 >gb|AAC35489.1| clp protease [Arabidopsis thaliana] Length = 310 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +2 Query: 176 RMPSFEQLDTTNMLLRQRIVFLGSQVDTM 262 R+PSFE+LDTTNMLLRQRIVFLGSQVD M Sbjct: 78 RLPSFEELDTTNMLLRQRIVFLGSQVDDM 106 >ref|NP_564880.1| ATP-dependent Clp protease proteolytic subunit 3 [Arabidopsis thaliana] gi|75314059|sp|Q9SXJ6.1|CLPP3_ARATH RecName: Full=ATP-dependent Clp protease proteolytic subunit 3, chloroplastic; AltName: Full=Endopeptidase ClpP3; Short=nClpP3; AltName: Full=nClpP4; Flags: Precursor gi|12322291|gb|AAG51173.1|AC079285_6 ATP-dependent Clp protease (nClpP3) [Arabidopsis thaliana] gi|12597762|gb|AAG60075.1|AC013288_9 ATP-dependent Clp protease (nClpP3) [Arabidopsis thaliana] gi|5360591|dbj|BAA82067.1| nClpP3 [Arabidopsis thaliana] gi|21592949|gb|AAM64899.1| ATP-dependent Clp protease proteolytic subunit ClpP3 [Arabidopsis thaliana] gi|332196422|gb|AEE34543.1| ATP-dependent Clp protease proteolytic subunit 3 [Arabidopsis thaliana] Length = 309 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +2 Query: 176 RMPSFEQLDTTNMLLRQRIVFLGSQVDTM 262 R+PSFE+LDTTNMLLRQRIVFLGSQVD M Sbjct: 77 RLPSFEELDTTNMLLRQRIVFLGSQVDDM 105 >ref|XP_002888528.1| hypothetical protein ARALYDRAFT_894344 [Arabidopsis lyrata subsp. lyrata] gi|297334369|gb|EFH64787.1| hypothetical protein ARALYDRAFT_894344 [Arabidopsis lyrata subsp. lyrata] Length = 308 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +2 Query: 176 RMPSFEQLDTTNMLLRQRIVFLGSQVDTM 262 R+PSFE+LDTTNMLLRQRIVFLGSQVD M Sbjct: 76 RLPSFEELDTTNMLLRQRIVFLGSQVDDM 104 >ref|XP_002532641.1| ATP-dependent Clp protease proteolytic subunit, putative [Ricinus communis] gi|223527632|gb|EEF29744.1| ATP-dependent Clp protease proteolytic subunit, putative [Ricinus communis] Length = 334 Score = 55.5 bits (132), Expect = 7e-06 Identities = 32/65 (49%), Positives = 39/65 (60%), Gaps = 2/65 (3%) Frame = +2 Query: 74 RSRRNLSVSAVSRRGRTLXXXXXXXXXXXXXAAFR--MPSFEQLDTTNMLLRQRIVFLGS 247 + R+ +SV AV+ R TL A +P FE+LDTTNMLLRQRI+FLGS Sbjct: 48 KRRKPISVKAVNTRKETLSSNWDVANFSSSFATSSPALPRFEELDTTNMLLRQRIIFLGS 107 Query: 248 QVDTM 262 QVD M Sbjct: 108 QVDDM 112 >emb|CAB89185.1| ClpP [Brassica napus var. napus] Length = 313 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +2 Query: 176 RMPSFEQLDTTNMLLRQRIVFLGSQVDTM 262 R+PSFE+LDTTNMLLRQRIVFLGSQVD M Sbjct: 81 RLPSFEELDTTNMLLRQRIVFLGSQVDDM 109 >emb|CAC80640.1| ClpP putative protein [Brassica napus] Length = 313 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +2 Query: 176 RMPSFEQLDTTNMLLRQRIVFLGSQVDTM 262 R+PSFE+LDTTNMLLRQRIVFLGSQVD M Sbjct: 81 RLPSFEELDTTNMLLRQRIVFLGSQVDDM 109 >gb|AAK48955.1|AF370528_1 ATP-dependent Clp protease; nClpP3 [Arabidopsis thaliana] gi|18377550|gb|AAL66941.1| ATP-dependent Clp protease (nClpP3) [Arabidopsis thaliana] Length = 309 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +2 Query: 176 RMPSFEQLDTTNMLLRQRIVFLGSQVDTM 262 R+PSFE+LDTTNMLLRQRIVFLGSQVD M Sbjct: 77 RLPSFEELDTTNMLLRQRIVFLGSQVDDM 105 >gb|AAL34333.1|L41144_1 ClpP [Brassica oleracea] Length = 279 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +2 Query: 176 RMPSFEQLDTTNMLLRQRIVFLGSQVDTM 262 R+PSFE+LDTTNMLLRQRIVFLGSQVD M Sbjct: 47 RLPSFEELDTTNMLLRQRIVFLGSQVDDM 75