BLASTX nr result
ID: Zingiber25_contig00024353
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00024353 (291 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC31925.1| hypothetical protein L484_009775 [Morus notabilis] 63 5e-08 gb|EXB54435.1| hypothetical protein L484_018993 [Morus notabilis] 62 6e-08 >gb|EXC31925.1| hypothetical protein L484_009775 [Morus notabilis] Length = 181 Score = 62.8 bits (151), Expect = 5e-08 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = -3 Query: 289 CLSCYQEHVKDPLKCAQAVRNFADCVRQTRIQVSSVK 179 CL+CY+EH+KDPLKCA VRNFADC R+ R QVSS + Sbjct: 145 CLACYKEHLKDPLKCADLVRNFADCARRARQQVSSAR 181 >gb|EXB54435.1| hypothetical protein L484_018993 [Morus notabilis] Length = 181 Score = 62.4 bits (150), Expect = 6e-08 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = -3 Query: 289 CLSCYQEHVKDPLKCAQAVRNFADCVRQTRIQVSSVK 179 CL+CY+EH+KDPLKCA VRNFADC R+ R QVSS + Sbjct: 145 CLACYKEHLKDPLKCADLVRNFADCARRVRQQVSSAQ 181