BLASTX nr result
ID: Zingiber25_contig00022838
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00022838 (301 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004141526.1| PREDICTED: ribosome biogenesis protein BOP1 ... 62 6e-08 dbj|BAE71307.1| putative WD-40 repeat protein [Trifolium pratense] 58 2e-06 ref|XP_003592946.1| Ribosome biogenesis protein bop1 [Medicago t... 57 2e-06 ref|XP_003548639.1| PREDICTED: ribosome biogenesis protein BOP1 ... 57 3e-06 gb|EMS58264.1| Ribosome biogenesis protein BOP1-like protein [Tr... 55 1e-05 ref|XP_003635118.1| PREDICTED: ribosome biogenesis protein BOP1 ... 55 1e-05 emb|CBI25674.3| unnamed protein product [Vitis vinifera] 55 1e-05 >ref|XP_004141526.1| PREDICTED: ribosome biogenesis protein BOP1 homolog [Cucumis sativus] gi|449517291|ref|XP_004165679.1| PREDICTED: ribosome biogenesis protein BOP1 homolog [Cucumis sativus] Length = 724 Score = 62.4 bits (150), Expect = 6e-08 Identities = 33/91 (36%), Positives = 50/91 (54%) Frame = -3 Query: 278 CLEEVVLSGKQRLVFWSRPPQLCWIDLFFVSVIVSGD*RVQRGCDVLILDTGLGSAKNQA 99 CL+ + L + V W+ P L + G DVL+L+TGLG + QA Sbjct: 425 CLKVLELGEPVKYVAWNPRPDLPIL-------------AAAAGADVLLLNTGLGDGEVQA 471 Query: 98 RVKELLHVEESKLEEDEGNTTPAVRWVRDDK 6 ++KE+LHV++ + E+ GN TPA W++DDK Sbjct: 472 KIKEVLHVDKLPVTENSGNKTPAATWLQDDK 502 >dbj|BAE71307.1| putative WD-40 repeat protein [Trifolium pratense] Length = 738 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/53 (50%), Positives = 36/53 (67%) Frame = -3 Query: 161 VQRGCDVLILDTGLGSAKNQARVKELLHVEESKLEEDEGNTTPAVRWVRDDKY 3 V G DVL+L+TGLG + Q RVKELL V+ K E+ G P+V W++DDK+ Sbjct: 464 VSVGQDVLLLNTGLGDEEEQQRVKELLLVDSPKASEETGKKAPSVSWLKDDKH 516 >ref|XP_003592946.1| Ribosome biogenesis protein bop1 [Medicago truncatula] gi|355481994|gb|AES63197.1| Ribosome biogenesis protein bop1 [Medicago truncatula] Length = 786 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/53 (45%), Positives = 37/53 (69%) Frame = -3 Query: 161 VQRGCDVLILDTGLGSAKNQARVKELLHVEESKLEEDEGNTTPAVRWVRDDKY 3 V G DVL+L+TGLG + Q R+KELL ++ + ++ G P+VRW++DDK+ Sbjct: 469 VSAGHDVLLLNTGLGDEEEQQRIKELLLIDSPEASDETGKKAPSVRWLKDDKH 521 >ref|XP_003548639.1| PREDICTED: ribosome biogenesis protein BOP1 homolog [Glycine max] Length = 718 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/53 (49%), Positives = 36/53 (67%) Frame = -3 Query: 161 VQRGCDVLILDTGLGSAKNQARVKELLHVEESKLEEDEGNTTPAVRWVRDDKY 3 V G DVL+L+T LG + Q R+KELL V+ S +D GN P+V W++DDK+ Sbjct: 445 VSVGQDVLLLNTCLGDEEEQKRIKELLWVDSSTASDDSGNKAPSVSWLKDDKH 497 >gb|EMS58264.1| Ribosome biogenesis protein BOP1-like protein [Triticum urartu] Length = 774 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/53 (47%), Positives = 37/53 (69%) Frame = -3 Query: 161 VQRGCDVLILDTGLGSAKNQARVKELLHVEESKLEEDEGNTTPAVRWVRDDKY 3 + G D+L+L+ +G + Q R K+LLHVEE ED+G+ PAVRWV++DK+ Sbjct: 429 IHNGRDLLLLNAEVGDEETQVRTKQLLHVEE-PTPEDDGDKKPAVRWVKNDKF 480 >ref|XP_003635118.1| PREDICTED: ribosome biogenesis protein BOP1 homolog [Vitis vinifera] Length = 691 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/53 (47%), Positives = 36/53 (67%) Frame = -3 Query: 161 VQRGCDVLILDTGLGSAKNQARVKELLHVEESKLEEDEGNTTPAVRWVRDDKY 3 V G DVL+L+TGLG+ + Q +++LL +E +D GNTT V WV+DDK+ Sbjct: 445 VSSGQDVLLLNTGLGNDEEQKNIEQLLRIETPGSMDDTGNTTSIVSWVQDDKH 497 >emb|CBI25674.3| unnamed protein product [Vitis vinifera] Length = 706 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/53 (47%), Positives = 36/53 (67%) Frame = -3 Query: 161 VQRGCDVLILDTGLGSAKNQARVKELLHVEESKLEEDEGNTTPAVRWVRDDKY 3 V G DVL+L+TGLG+ + Q +++LL +E +D GNTT V WV+DDK+ Sbjct: 445 VSSGQDVLLLNTGLGNDEEQKNIEQLLRIETPGSMDDTGNTTSIVSWVQDDKH 497