BLASTX nr result
ID: Zingiber25_contig00022316
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00022316 (412 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_003831159.1| GDSL-family lipase/acylhydrolase [Butyrivibr... 47 4e-06 >ref|YP_003831159.1| GDSL-family lipase/acylhydrolase [Butyrivibrio proteoclasticus B316] gi|503046255|ref|WP_013281231.1| GDSL-family lipase/acylhydrolase [Butyrivibrio proteoclasticus] gi|302395672|gb|ADL34577.1| GDSL-family lipase/acylhydrolase [Butyrivibrio proteoclasticus B316] Length = 557 Score = 46.6 bits (109), Expect(2) = 4e-06 Identities = 28/78 (35%), Positives = 46/78 (58%) Frame = -2 Query: 285 ASEEKKRSHTQTQTLKPYRATSEEKKRAHMEKKQRAGGEEESTEEKRTRGVEEEDRDAEE 106 A EEKK++ + Q + EEKK+A E++++A E++ EE+ + VEEE+++ E Sbjct: 468 AEEEKKKAEEEEQ-----KKAEEEKKKAEEEEQKKAEEEKKKAEEEEKKKVEEENKEESE 522 Query: 105 KKTSRQIWGNVDSGIRAG 52 KK + N +SG AG Sbjct: 523 KKEGEK-EENGNSGNSAG 539 Score = 29.6 bits (65), Expect(2) = 4e-06 Identities = 16/44 (36%), Positives = 22/44 (50%) Frame = -1 Query: 397 EGSKKAAETSPKPEQEQKSLEPEQERRRIRQTKKIHGGVGGEEE 266 E KKA E K E+E+K E E+++ + KK EEE Sbjct: 392 EEKKKAEEEKKKAEEEKKKAEEEKKKAEEEKKKKAEEEKKAEEE 435