BLASTX nr result
ID: Zingiber25_contig00020909
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00020909 (1793 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003600828.1| hypothetical protein MTR_3g069850 [Medicago ... 65 1e-07 >ref|XP_003600828.1| hypothetical protein MTR_3g069850 [Medicago truncatula] gi|355489876|gb|AES71079.1| hypothetical protein MTR_3g069850 [Medicago truncatula] Length = 172 Score = 64.7 bits (156), Expect = 1e-07 Identities = 30/45 (66%), Positives = 36/45 (80%) Frame = -1 Query: 539 RLAPQTIGGPFNMLCPHSHAPWKTSQEVTHPQISPSQARLTLEFL 405 RL PQT F + CPHSHA KTS++VTHP+I+PSQARLT+EFL Sbjct: 13 RLTPQTNTSLFGVFCPHSHACRKTSRQVTHPKIAPSQARLTVEFL 57