BLASTX nr result
ID: Zingiber25_contig00020668
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00020668 (689 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004148382.1| PREDICTED: GATA transcription factor 26-like... 59 1e-06 >ref|XP_004148382.1| PREDICTED: GATA transcription factor 26-like [Cucumis sativus] gi|449517838|ref|XP_004165951.1| PREDICTED: GATA transcription factor 26-like [Cucumis sativus] Length = 541 Score = 58.9 bits (141), Expect = 1e-06 Identities = 37/109 (33%), Positives = 58/109 (53%), Gaps = 1/109 (0%) Frame = +1 Query: 16 KRVCRSGVMN-PPSKCSTQLDSCLLAKVIDGPGQFAHHDRVCFSPKRVASALPDKTSTFS 192 K++C S N P +K + L+ K PG+ +D CFSP+ + + PD +S Sbjct: 430 KQLCESYNQNIPEAKTILKSPKRLVMKENKDPGE---NDGSCFSPRSLFALPPDGSSLML 486 Query: 193 SPIQFIADSSESDMLLDVPTGTSFAEAELLYHPWVKKANRDGSPTKSVI 339 + F+ +SS+ D+LLDV + +SF +AELL HP + R S S + Sbjct: 487 ESLHFVEESSDQDLLLDVRSNSSFPQAELL-HPTSRSGGRQASTCSSSV 534