BLASTX nr result
ID: Zingiber25_contig00020571
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00020571 (586 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006847833.1| hypothetical protein AMTR_s00029p00054270 [A... 60 5e-07 >ref|XP_006847833.1| hypothetical protein AMTR_s00029p00054270 [Amborella trichopoda] gi|548851138|gb|ERN09414.1| hypothetical protein AMTR_s00029p00054270 [Amborella trichopoda] Length = 273 Score = 59.7 bits (143), Expect = 5e-07 Identities = 26/50 (52%), Positives = 39/50 (78%), Gaps = 3/50 (6%) Frame = +1 Query: 1 SHFAAICMGIDENDTGKEHD---LLKLKVWKTLPYMEDECLSDSEAVIKI 141 SH+AAICM ++ND E D ++KLK WKT+PY+EDEC+S +++++KI Sbjct: 220 SHYAAICM--EQNDNSNEVDSSGMIKLKAWKTIPYIEDECISGTDSIVKI 267