BLASTX nr result
ID: Zingiber25_contig00020442
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00020442 (686 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006847924.1| hypothetical protein AMTR_s00029p00122290 [A... 68 3e-09 >ref|XP_006847924.1| hypothetical protein AMTR_s00029p00122290 [Amborella trichopoda] gi|548851229|gb|ERN09505.1| hypothetical protein AMTR_s00029p00122290 [Amborella trichopoda] Length = 667 Score = 67.8 bits (164), Expect = 3e-09 Identities = 35/56 (62%), Positives = 41/56 (73%), Gaps = 2/56 (3%) Frame = -3 Query: 162 AETPPGLHILLHQQV--KEHAPTLISSHADRDRVIEVFRNALLKTGPPESFALQAV 1 AE P L ILLHQQ KE +P +SSHADR+RV+EVFR AL + GPP +FALQ V Sbjct: 2 AEATPQLRILLHQQQPQKERSPITVSSHADRNRVLEVFRRALSQVGPPANFALQTV 57