BLASTX nr result
ID: Zingiber25_contig00020076
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00020076 (474 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_563792.3| DOF transcription factor OBP2 [Arabidopsis thal... 56 4e-06 gb|AAM65740.1| zinc finger protein OBP2 [Arabidopsis thaliana] 56 4e-06 ref|NP_001030988.1| DOF transcription factor OBP2 [Arabidopsis t... 56 4e-06 ref|NP_850938.1| DOF transcription factor OBP2 [Arabidopsis thal... 56 4e-06 >ref|NP_563792.3| DOF transcription factor OBP2 [Arabidopsis thaliana] gi|60392196|sp|Q8L9V6.2|DOF11_ARATH RecName: Full=Dof zinc finger protein DOF1.1; Short=AtDOF1.1; AltName: Full=OBF-binding protein 2 gi|332190031|gb|AEE28152.1| Dof zinc finger protein DOF1.1 [Arabidopsis thaliana] Length = 331 Score = 56.2 bits (134), Expect = 4e-06 Identities = 23/38 (60%), Positives = 28/38 (73%) Frame = +3 Query: 360 GSAKAERKKQSVRTAAAAPLSCPRCESTNTKFCYYNNY 473 G + AER +Q+ A PL CPRC+S+NTKFCYYNNY Sbjct: 58 GGSMAERARQANIPPLAGPLKCPRCDSSNTKFCYYNNY 95 >gb|AAM65740.1| zinc finger protein OBP2 [Arabidopsis thaliana] Length = 331 Score = 56.2 bits (134), Expect = 4e-06 Identities = 23/38 (60%), Positives = 28/38 (73%) Frame = +3 Query: 360 GSAKAERKKQSVRTAAAAPLSCPRCESTNTKFCYYNNY 473 G + AER +Q+ A PL CPRC+S+NTKFCYYNNY Sbjct: 58 GGSMAERARQANIPPLAGPLKCPRCDSSNTKFCYYNNY 95 >ref|NP_001030988.1| DOF transcription factor OBP2 [Arabidopsis thaliana] gi|8439908|gb|AAF75094.1|AC007583_30 Strong similarity to zinc finger protein OBP2 from Arabidopsis thaliana gb|AF155816. EST gb|N65215 comes from this gene [Arabidopsis thaliana] gi|332190033|gb|AEE28154.1| Dof zinc finger protein DOF1.1 [Arabidopsis thaliana] Length = 339 Score = 56.2 bits (134), Expect = 4e-06 Identities = 23/38 (60%), Positives = 28/38 (73%) Frame = +3 Query: 360 GSAKAERKKQSVRTAAAAPLSCPRCESTNTKFCYYNNY 473 G + AER +Q+ A PL CPRC+S+NTKFCYYNNY Sbjct: 66 GGSMAERARQANIPPLAGPLKCPRCDSSNTKFCYYNNY 103 >ref|NP_850938.1| DOF transcription factor OBP2 [Arabidopsis thaliana] gi|17065278|gb|AAL32793.1| Strong similarity to zinc finger protein OBP2 [Arabidopsis thaliana] gi|20260006|gb|AAM13350.1| strong similarity to zinc finger protein OBP2 [Arabidopsis thaliana] gi|332190032|gb|AEE28153.1| Dof zinc finger protein DOF1.1 [Arabidopsis thaliana] Length = 275 Score = 56.2 bits (134), Expect = 4e-06 Identities = 23/38 (60%), Positives = 28/38 (73%) Frame = +3 Query: 360 GSAKAERKKQSVRTAAAAPLSCPRCESTNTKFCYYNNY 473 G + AER +Q+ A PL CPRC+S+NTKFCYYNNY Sbjct: 2 GGSMAERARQANIPPLAGPLKCPRCDSSNTKFCYYNNY 39