BLASTX nr result
ID: Zingiber25_contig00020034
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00020034 (340 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_187124.1| auxin-responsive protein IAA16 [Arabidopsis tha... 75 1e-11 ref|XP_006298436.1| hypothetical protein CARUB_v10014507mg [Caps... 75 1e-11 gb|EMJ25009.1| hypothetical protein PRUPE_ppa010698mg [Prunus pe... 75 1e-11 gb|ADL70680.1| indole-3-acetic acid inducible 16 [Arabidopsis th... 75 1e-11 gb|ADL70673.1| indole-3-acetic acid inducible 16 [Arabidopsis th... 75 1e-11 gb|ADL70671.1| indole-3-acetic acid inducible 16 [Arabidopsis th... 75 1e-11 gb|ADL70670.1| indole-3-acetic acid inducible 16 [Arabidopsis th... 75 1e-11 ref|XP_002884465.1| indoleacetic acid-induced protein 16 [Arabid... 75 1e-11 dbj|BAD94452.1| auxin-induced protein [Arabidopsis thaliana] 75 1e-11 gb|EOY11069.1| Indoleacetic acid-induced protein 16 [Theobroma c... 74 2e-11 gb|AAD32146.1|AF123508_1 Nt-iaa28 deduced protein [Nicotiana tab... 74 2e-11 gb|AAD32147.1|AF123509_1 Nt-iaa4.1 deduced protein [Nicotiana ta... 74 2e-11 gb|AEE25654.1| auxin-responsive protein [Gossypium hirsutum] 74 2e-11 ref|NP_001266049.1| IAA9 protein [Solanum lycopersicum] gi|36581... 74 2e-11 ref|NP_001275398.1| auxin/indole-3-acetic acid 3 [Solanum tubero... 74 2e-11 ref|XP_004288427.1| PREDICTED: auxin-responsive protein IAA14-li... 74 3e-11 gb|AFS44507.1| auxin repressor, partial [Fragaria x ananassa] 74 3e-11 ref|NP_001266039.1| IAA7 protein [Solanum lycopersicum] gi|36581... 74 3e-11 gb|ADL70678.1| indole-3-acetic acid inducible 16 [Arabidopsis th... 74 3e-11 gb|ADL70672.1| indole-3-acetic acid inducible 16 [Arabidopsis th... 74 3e-11 >ref|NP_187124.1| auxin-responsive protein IAA16 [Arabidopsis thaliana] gi|11131089|sp|O24407.1|IAA16_ARATH RecName: Full=Auxin-responsive protein IAA16; AltName: Full=Indoleacetic acid-induced protein 16 gi|6175173|gb|AAF04899.1|AC011437_14 auxin-induced protein [Arabidopsis thaliana] gi|12083210|gb|AAG48764.1|AF332400_1 auxin-induced protein IAA16 [Arabidopsis thaliana] gi|14030659|gb|AAK53004.1|AF375420_1 AT3g04730/F7O18_22 [Arabidopsis thaliana] gi|2618721|gb|AAB84353.1| IAA16 [Arabidopsis thaliana] gi|21592802|gb|AAM64751.1| auxin-induced protein [Arabidopsis thaliana] gi|23507781|gb|AAN38694.1| At3g04730/F7O18_22 [Arabidopsis thaliana] gi|110738766|dbj|BAF01307.1| auxin-induced protein [Arabidopsis thaliana] gi|332640606|gb|AEE74127.1| auxin-responsive protein IAA16 [Arabidopsis thaliana] Length = 236 Score = 74.7 bits (182), Expect = 1e-11 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +3 Query: 3 VPWEMFVDSCKRLRIMKGSEAIGLAPRALEKCKNTS 110 VPWEMFVDSCKR+RIMKGSEAIGLAPRALEKCKN S Sbjct: 201 VPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNRS 236 >ref|XP_006298436.1| hypothetical protein CARUB_v10014507mg [Capsella rubella] gi|482567145|gb|EOA31334.1| hypothetical protein CARUB_v10014507mg [Capsella rubella] Length = 241 Score = 74.7 bits (182), Expect = 1e-11 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +3 Query: 3 VPWEMFVDSCKRLRIMKGSEAIGLAPRALEKCKNTS 110 VPWEMFVDSCKR+RIMKGSEAIGLAPRALEKCKN S Sbjct: 206 VPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNRS 241 >gb|EMJ25009.1| hypothetical protein PRUPE_ppa010698mg [Prunus persica] Length = 239 Score = 74.7 bits (182), Expect = 1e-11 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +3 Query: 3 VPWEMFVDSCKRLRIMKGSEAIGLAPRALEKCKNTS 110 VPWEMFVDSCKRLRIMKGSEAIGLAPRA+EKCKN S Sbjct: 204 VPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKNRS 239 >gb|ADL70680.1| indole-3-acetic acid inducible 16 [Arabidopsis thaliana] Length = 152 Score = 74.7 bits (182), Expect = 1e-11 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +3 Query: 3 VPWEMFVDSCKRLRIMKGSEAIGLAPRALEKCKNTS 110 VPWEMFVDSCKR+RIMKGSEAIGLAPRALEKCKN S Sbjct: 117 VPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNRS 152 >gb|ADL70673.1| indole-3-acetic acid inducible 16 [Arabidopsis thaliana] gi|304322374|gb|ADL70674.1| indole-3-acetic acid inducible 16 [Arabidopsis thaliana] Length = 165 Score = 74.7 bits (182), Expect = 1e-11 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +3 Query: 3 VPWEMFVDSCKRLRIMKGSEAIGLAPRALEKCKNTS 110 VPWEMFVDSCKR+RIMKGSEAIGLAPRALEKCKN S Sbjct: 130 VPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNRS 165 >gb|ADL70671.1| indole-3-acetic acid inducible 16 [Arabidopsis thaliana] Length = 167 Score = 74.7 bits (182), Expect = 1e-11 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +3 Query: 3 VPWEMFVDSCKRLRIMKGSEAIGLAPRALEKCKNTS 110 VPWEMFVDSCKR+RIMKGSEAIGLAPRALEKCKN S Sbjct: 132 VPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNRS 167 >gb|ADL70670.1| indole-3-acetic acid inducible 16 [Arabidopsis thaliana] Length = 156 Score = 74.7 bits (182), Expect = 1e-11 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +3 Query: 3 VPWEMFVDSCKRLRIMKGSEAIGLAPRALEKCKNTS 110 VPWEMFVDSCKR+RIMKGSEAIGLAPRALEKCKN S Sbjct: 121 VPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNRS 156 >ref|XP_002884465.1| indoleacetic acid-induced protein 16 [Arabidopsis lyrata subsp. lyrata] gi|297330305|gb|EFH60724.1| indoleacetic acid-induced protein 16 [Arabidopsis lyrata subsp. lyrata] Length = 236 Score = 74.7 bits (182), Expect = 1e-11 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +3 Query: 3 VPWEMFVDSCKRLRIMKGSEAIGLAPRALEKCKNTS 110 VPWEMFVDSCKR+RIMKGSEAIGLAPRALEKCKN S Sbjct: 201 VPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNRS 236 >dbj|BAD94452.1| auxin-induced protein [Arabidopsis thaliana] Length = 71 Score = 74.7 bits (182), Expect = 1e-11 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +3 Query: 3 VPWEMFVDSCKRLRIMKGSEAIGLAPRALEKCKNTS 110 VPWEMFVDSCKR+RIMKGSEAIGLAPRALEKCKN S Sbjct: 36 VPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNRS 71 >gb|EOY11069.1| Indoleacetic acid-induced protein 16 [Theobroma cacao] Length = 249 Score = 74.3 bits (181), Expect = 2e-11 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +3 Query: 3 VPWEMFVDSCKRLRIMKGSEAIGLAPRALEKCKNTS 110 VPWEMFVDSCKRLRIMKGSEAIGLAPRA+EKCKN S Sbjct: 214 VPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 249 >gb|AAD32146.1|AF123508_1 Nt-iaa28 deduced protein [Nicotiana tabacum] Length = 240 Score = 74.3 bits (181), Expect = 2e-11 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +3 Query: 3 VPWEMFVDSCKRLRIMKGSEAIGLAPRALEKCKNTS 110 VPWEMFVDSCKRLRIMKGSEAIGLAPRA+EKCKN S Sbjct: 205 VPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 240 >gb|AAD32147.1|AF123509_1 Nt-iaa4.1 deduced protein [Nicotiana tabacum] Length = 220 Score = 74.3 bits (181), Expect = 2e-11 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +3 Query: 3 VPWEMFVDSCKRLRIMKGSEAIGLAPRALEKCKNTS 110 VPWEMFVDSCKRLRIMKGSEAIGLAPRA+EKCKN S Sbjct: 185 VPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 220 >gb|AEE25654.1| auxin-responsive protein [Gossypium hirsutum] Length = 246 Score = 74.3 bits (181), Expect = 2e-11 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +3 Query: 3 VPWEMFVDSCKRLRIMKGSEAIGLAPRALEKCKNTS 110 VPWEMFVDSCKRLRIMKGSEAIGLAPRA+EKCKN S Sbjct: 211 VPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 246 >ref|NP_001266049.1| IAA9 protein [Solanum lycopersicum] gi|365818541|gb|AEX00359.1| IAA16 [Solanum lycopersicum] Length = 251 Score = 74.3 bits (181), Expect = 2e-11 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +3 Query: 3 VPWEMFVDSCKRLRIMKGSEAIGLAPRALEKCKNTS 110 VPWEMFVDSCKRLRIMKGSEAIGLAPRA+EKCKN S Sbjct: 216 VPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 251 >ref|NP_001275398.1| auxin/indole-3-acetic acid 3 [Solanum tuberosum] gi|256857790|gb|ACV31209.1| auxin/indole-3-acetic acid 3 [Solanum tuberosum] Length = 249 Score = 74.3 bits (181), Expect = 2e-11 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +3 Query: 3 VPWEMFVDSCKRLRIMKGSEAIGLAPRALEKCKNTS 110 VPWEMFVDSCKRLRIMKGSEAIGLAPRA+EKCKN S Sbjct: 214 VPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 249 >ref|XP_004288427.1| PREDICTED: auxin-responsive protein IAA14-like [Fragaria vesca subsp. vesca] Length = 238 Score = 73.6 bits (179), Expect = 3e-11 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = +3 Query: 3 VPWEMFVDSCKRLRIMKGSEAIGLAPRALEKCKNTS 110 VPWEMFVDSCKRLRIMKGSEAIGLAP+A+EKCKN S Sbjct: 203 VPWEMFVDSCKRLRIMKGSEAIGLAPKAMEKCKNRS 238 >gb|AFS44507.1| auxin repressor, partial [Fragaria x ananassa] Length = 231 Score = 73.6 bits (179), Expect = 3e-11 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = +3 Query: 3 VPWEMFVDSCKRLRIMKGSEAIGLAPRALEKCKNTS 110 VPWEMFVDSCKRLRIMKGSEAIGLAP+A+EKCKN S Sbjct: 196 VPWEMFVDSCKRLRIMKGSEAIGLAPKAMEKCKNRS 231 >ref|NP_001266039.1| IAA7 protein [Solanum lycopersicum] gi|365818525|gb|AEX00351.1| IAA7 [Solanum lycopersicum] Length = 218 Score = 73.6 bits (179), Expect = 3e-11 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = +3 Query: 3 VPWEMFVDSCKRLRIMKGSEAIGLAPRALEKCKNTS 110 VPW+MFVDSCKRLRIMKGSEAIGLAPRA+EKCKN S Sbjct: 183 VPWQMFVDSCKRLRIMKGSEAIGLAPRAMEKCKNRS 218 >gb|ADL70678.1| indole-3-acetic acid inducible 16 [Arabidopsis thaliana] Length = 161 Score = 73.6 bits (179), Expect = 3e-11 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = +3 Query: 3 VPWEMFVDSCKRLRIMKGSEAIGLAPRALEKCKN 104 VPWEMFVDSCKR+RIMKGSEAIGLAPRALEKCKN Sbjct: 127 VPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKN 160 >gb|ADL70672.1| indole-3-acetic acid inducible 16 [Arabidopsis thaliana] gi|304322376|gb|ADL70675.1| indole-3-acetic acid inducible 16 [Arabidopsis thaliana] Length = 166 Score = 73.6 bits (179), Expect = 3e-11 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = +3 Query: 3 VPWEMFVDSCKRLRIMKGSEAIGLAPRALEKCKN 104 VPWEMFVDSCKR+RIMKGSEAIGLAPRALEKCKN Sbjct: 132 VPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKN 165