BLASTX nr result
ID: Zingiber25_contig00019870
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00019870 (254 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006342954.1| PREDICTED: threonine synthase, chloroplastic... 163 2e-38 ref|XP_004235576.1| PREDICTED: threonine synthase, chloroplastic... 163 2e-38 ref|NP_001274994.1| threonine synthase, chloroplastic [Solanum t... 163 2e-38 ref|XP_002285366.1| PREDICTED: threonine synthase, chloroplastic... 162 3e-38 ref|XP_006465969.1| PREDICTED: threonine synthase, chloroplastic... 162 4e-38 ref|XP_006426606.1| hypothetical protein CICLE_v10025353mg [Citr... 162 4e-38 ref|XP_006412802.1| hypothetical protein EUTSA_v10024890mg [Eutr... 161 7e-38 ref|XP_006300050.1| hypothetical protein CARUB_v10016276mg [Caps... 161 7e-38 ref|XP_006296037.1| hypothetical protein CARUB_v10025183mg [Caps... 161 7e-38 gb|AAB04607.1| threonine synthase, partial [Arabidopsis thaliana] 161 7e-38 pdb|2C2B|A Chain A, Crystallographic Structure Of Arabidopsis Th... 161 7e-38 ref|NP_194713.1| threonine synthase [Arabidopsis thaliana] gi|20... 161 7e-38 ref|XP_002514088.1| threonine synthase, putative [Ricinus commun... 161 7e-38 ref|XP_006357395.1| PREDICTED: threonine synthase, chloroplastic... 161 9e-38 ref|XP_004241890.1| PREDICTED: threonine synthase, chloroplastic... 161 9e-38 ref|XP_002521363.1| threonine synthase, putative [Ricinus commun... 161 9e-38 gb|EXB38901.1| Threonine synthase 1 [Morus notabilis] 160 2e-37 ref|XP_002867385.1| methionine over-accumulator [Arabidopsis lyr... 159 3e-37 gb|EXB29687.1| Threonine synthase [Morus notabilis] 159 4e-37 ref|XP_004288966.1| PREDICTED: threonine synthase 1, chloroplast... 159 4e-37 >ref|XP_006342954.1| PREDICTED: threonine synthase, chloroplastic [Solanum tuberosum] Length = 519 Score = 163 bits (412), Expect = 2e-38 Identities = 75/84 (89%), Positives = 79/84 (94%) Frame = -1 Query: 254 AIEILQQFDWEVPDWVIVPGGNLGNIYAFYKGFEMCRELELVDRVPRLVCAQAANANPLY 75 AIEILQQFDWEVP+WVIVPGGNLGNIYAFYKGF+MC+EL LVDR+PRLVCAQAANANPLY Sbjct: 308 AIEILQQFDWEVPEWVIVPGGNLGNIYAFYKGFQMCKELGLVDRIPRLVCAQAANANPLY 367 Query: 74 LHYKSGWADFKPVIAEDTFASAIQ 3 LHYKSGW DFKPV A TFASAIQ Sbjct: 368 LHYKSGWKDFKPVKANTTFASAIQ 391 >ref|XP_004235576.1| PREDICTED: threonine synthase, chloroplastic-like isoform 1 [Solanum lycopersicum] gi|460379656|ref|XP_004235577.1| PREDICTED: threonine synthase, chloroplastic-like isoform 2 [Solanum lycopersicum] Length = 519 Score = 163 bits (412), Expect = 2e-38 Identities = 75/84 (89%), Positives = 79/84 (94%) Frame = -1 Query: 254 AIEILQQFDWEVPDWVIVPGGNLGNIYAFYKGFEMCRELELVDRVPRLVCAQAANANPLY 75 AIEILQQFDWEVP+WVIVPGGNLGNIYAFYKGF+MC+EL LVDR+PRLVCAQAANANPLY Sbjct: 308 AIEILQQFDWEVPEWVIVPGGNLGNIYAFYKGFQMCKELGLVDRIPRLVCAQAANANPLY 367 Query: 74 LHYKSGWADFKPVIAEDTFASAIQ 3 LHYKSGW DFKPV A TFASAIQ Sbjct: 368 LHYKSGWKDFKPVKANTTFASAIQ 391 >ref|NP_001274994.1| threonine synthase, chloroplastic [Solanum tuberosum] gi|20140867|sp|Q9MT28.1|THRC_SOLTU RecName: Full=Threonine synthase, chloroplastic; Short=TS; Flags: Precursor gi|8439547|gb|AAF74984.1|AF082894_1 threonine synthase [Solanum tuberosum] Length = 519 Score = 163 bits (412), Expect = 2e-38 Identities = 75/84 (89%), Positives = 79/84 (94%) Frame = -1 Query: 254 AIEILQQFDWEVPDWVIVPGGNLGNIYAFYKGFEMCRELELVDRVPRLVCAQAANANPLY 75 AIEILQQFDWEVP+WVIVPGGNLGNIYAFYKGF+MC+EL LVDR+PRLVCAQAANANPLY Sbjct: 308 AIEILQQFDWEVPEWVIVPGGNLGNIYAFYKGFQMCKELGLVDRIPRLVCAQAANANPLY 367 Query: 74 LHYKSGWADFKPVIAEDTFASAIQ 3 LHYKSGW DFKPV A TFASAIQ Sbjct: 368 LHYKSGWKDFKPVKANTTFASAIQ 391 >ref|XP_002285366.1| PREDICTED: threonine synthase, chloroplastic [Vitis vinifera] Length = 522 Score = 162 bits (411), Expect = 3e-38 Identities = 75/84 (89%), Positives = 78/84 (92%) Frame = -1 Query: 254 AIEILQQFDWEVPDWVIVPGGNLGNIYAFYKGFEMCRELELVDRVPRLVCAQAANANPLY 75 AIEILQQFDWEVPDWVIVPGGNLGNIYAFYKGF MC+EL LVDR+PRLVCAQAANANPLY Sbjct: 311 AIEILQQFDWEVPDWVIVPGGNLGNIYAFYKGFHMCKELGLVDRIPRLVCAQAANANPLY 370 Query: 74 LHYKSGWADFKPVIAEDTFASAIQ 3 LHYKSGW +FKPV A TFASAIQ Sbjct: 371 LHYKSGWGEFKPVKANTTFASAIQ 394 >ref|XP_006465969.1| PREDICTED: threonine synthase, chloroplastic-like isoform X1 [Citrus sinensis] Length = 526 Score = 162 bits (410), Expect = 4e-38 Identities = 75/84 (89%), Positives = 79/84 (94%) Frame = -1 Query: 254 AIEILQQFDWEVPDWVIVPGGNLGNIYAFYKGFEMCRELELVDRVPRLVCAQAANANPLY 75 AIEILQQFDWEVPDWVIVPGGNLGNIYAFYKGF+MC+EL LVDR+PRLVCAQAANANPLY Sbjct: 315 AIEILQQFDWEVPDWVIVPGGNLGNIYAFYKGFQMCKELGLVDRIPRLVCAQAANANPLY 374 Query: 74 LHYKSGWADFKPVIAEDTFASAIQ 3 L+YKSGW DFKPV A TFASAIQ Sbjct: 375 LYYKSGWKDFKPVRANTTFASAIQ 398 >ref|XP_006426606.1| hypothetical protein CICLE_v10025353mg [Citrus clementina] gi|557528596|gb|ESR39846.1| hypothetical protein CICLE_v10025353mg [Citrus clementina] Length = 526 Score = 162 bits (410), Expect = 4e-38 Identities = 75/84 (89%), Positives = 79/84 (94%) Frame = -1 Query: 254 AIEILQQFDWEVPDWVIVPGGNLGNIYAFYKGFEMCRELELVDRVPRLVCAQAANANPLY 75 AIEILQQFDWEVPDWVIVPGGNLGNIYAFYKGF+MC+EL LVDR+PRLVCAQAANANPLY Sbjct: 315 AIEILQQFDWEVPDWVIVPGGNLGNIYAFYKGFQMCKELGLVDRIPRLVCAQAANANPLY 374 Query: 74 LHYKSGWADFKPVIAEDTFASAIQ 3 L+YKSGW DFKPV A TFASAIQ Sbjct: 375 LYYKSGWKDFKPVRANTTFASAIQ 398 >ref|XP_006412802.1| hypothetical protein EUTSA_v10024890mg [Eutrema salsugineum] gi|557113972|gb|ESQ54255.1| hypothetical protein EUTSA_v10024890mg [Eutrema salsugineum] Length = 531 Score = 161 bits (408), Expect = 7e-38 Identities = 73/84 (86%), Positives = 79/84 (94%) Frame = -1 Query: 254 AIEILQQFDWEVPDWVIVPGGNLGNIYAFYKGFEMCRELELVDRVPRLVCAQAANANPLY 75 AIEILQQFDW+VPDWVIVPGGNLGNIYAFYKGF+MC+EL LVDR+PR+VCAQAANANPLY Sbjct: 320 AIEILQQFDWQVPDWVIVPGGNLGNIYAFYKGFKMCQELGLVDRIPRMVCAQAANANPLY 379 Query: 74 LHYKSGWADFKPVIAEDTFASAIQ 3 LHYKSGW DFKP+ A TFASAIQ Sbjct: 380 LHYKSGWKDFKPMTASTTFASAIQ 403 >ref|XP_006300050.1| hypothetical protein CARUB_v10016276mg [Capsella rubella] gi|482568759|gb|EOA32948.1| hypothetical protein CARUB_v10016276mg [Capsella rubella] Length = 521 Score = 161 bits (408), Expect = 7e-38 Identities = 74/84 (88%), Positives = 79/84 (94%) Frame = -1 Query: 254 AIEILQQFDWEVPDWVIVPGGNLGNIYAFYKGFEMCRELELVDRVPRLVCAQAANANPLY 75 AIEILQQF+WEVPDWVIVPGGNLGNIYAFYKGF+MC+EL LVDR+PRLVCAQAANANPLY Sbjct: 311 AIEILQQFNWEVPDWVIVPGGNLGNIYAFYKGFKMCKELGLVDRIPRLVCAQAANANPLY 370 Query: 74 LHYKSGWADFKPVIAEDTFASAIQ 3 LHYK+GW DFKPV A TFASAIQ Sbjct: 371 LHYKAGWKDFKPVKASSTFASAIQ 394 >ref|XP_006296037.1| hypothetical protein CARUB_v10025183mg [Capsella rubella] gi|482564745|gb|EOA28935.1| hypothetical protein CARUB_v10025183mg [Capsella rubella] Length = 529 Score = 161 bits (408), Expect = 7e-38 Identities = 73/84 (86%), Positives = 79/84 (94%) Frame = -1 Query: 254 AIEILQQFDWEVPDWVIVPGGNLGNIYAFYKGFEMCRELELVDRVPRLVCAQAANANPLY 75 AIEILQQFDW+VPDWVIVPGGNLGNIYAFYKGF+MC+EL LVDR+PR+VCAQAANANPLY Sbjct: 318 AIEILQQFDWQVPDWVIVPGGNLGNIYAFYKGFKMCQELGLVDRIPRMVCAQAANANPLY 377 Query: 74 LHYKSGWADFKPVIAEDTFASAIQ 3 LHYKSGW DFKP+ A TFASAIQ Sbjct: 378 LHYKSGWKDFKPMTASTTFASAIQ 401 >gb|AAB04607.1| threonine synthase, partial [Arabidopsis thaliana] Length = 525 Score = 161 bits (408), Expect = 7e-38 Identities = 73/84 (86%), Positives = 79/84 (94%) Frame = -1 Query: 254 AIEILQQFDWEVPDWVIVPGGNLGNIYAFYKGFEMCRELELVDRVPRLVCAQAANANPLY 75 AIEILQQFDW+VPDWVIVPGGNLGNIYAFYKGF+MC+EL LVDR+PR+VCAQAANANPLY Sbjct: 314 AIEILQQFDWQVPDWVIVPGGNLGNIYAFYKGFKMCQELGLVDRIPRMVCAQAANANPLY 373 Query: 74 LHYKSGWADFKPVIAEDTFASAIQ 3 LHYKSGW DFKP+ A TFASAIQ Sbjct: 374 LHYKSGWKDFKPMTASTTFASAIQ 397 >pdb|2C2B|A Chain A, Crystallographic Structure Of Arabidopsis Thaliana Threonine Synthase Complexed With Pyridoxal Phosphate And S-Adenosylmethionine gi|83754492|pdb|2C2B|B Chain B, Crystallographic Structure Of Arabidopsis Thaliana Threonine Synthase Complexed With Pyridoxal Phosphate And S-Adenosylmethionine gi|83754493|pdb|2C2B|C Chain C, Crystallographic Structure Of Arabidopsis Thaliana Threonine Synthase Complexed With Pyridoxal Phosphate And S-Adenosylmethionine gi|83754494|pdb|2C2B|D Chain D, Crystallographic Structure Of Arabidopsis Thaliana Threonine Synthase Complexed With Pyridoxal Phosphate And S-Adenosylmethionine gi|83754495|pdb|2C2B|E Chain E, Crystallographic Structure Of Arabidopsis Thaliana Threonine Synthase Complexed With Pyridoxal Phosphate And S-Adenosylmethionine gi|83754496|pdb|2C2B|F Chain F, Crystallographic Structure Of Arabidopsis Thaliana Threonine Synthase Complexed With Pyridoxal Phosphate And S-Adenosylmethionine gi|83754503|pdb|2C2G|A Chain A, Crystal Structure Of Threonine Synthase From Arabidopsis Thaliana In Complex With Its Cofactor Pyridoxal Phosphate gi|83754504|pdb|2C2G|B Chain B, Crystal Structure Of Threonine Synthase From Arabidopsis Thaliana In Complex With Its Cofactor Pyridoxal Phosphate Length = 486 Score = 161 bits (408), Expect = 7e-38 Identities = 73/84 (86%), Positives = 79/84 (94%) Frame = -1 Query: 254 AIEILQQFDWEVPDWVIVPGGNLGNIYAFYKGFEMCRELELVDRVPRLVCAQAANANPLY 75 AIEILQQFDW+VPDWVIVPGGNLGNIYAFYKGF+MC+EL LVDR+PR+VCAQAANANPLY Sbjct: 275 AIEILQQFDWQVPDWVIVPGGNLGNIYAFYKGFKMCQELGLVDRIPRMVCAQAANANPLY 334 Query: 74 LHYKSGWADFKPVIAEDTFASAIQ 3 LHYKSGW DFKP+ A TFASAIQ Sbjct: 335 LHYKSGWKDFKPMTASTTFASAIQ 358 >ref|NP_194713.1| threonine synthase [Arabidopsis thaliana] gi|20140904|sp|Q9S7B5.1|THRC1_ARATH RecName: Full=Threonine synthase 1, chloroplastic; AltName: Full=Protein METHIONINE OVER-ACCUMULATOR 2; Flags: Precursor gi|4850369|dbj|BAA77707.1| threonine synthase [Arabidopsis thaliana] gi|4914408|emb|CAB43659.1| threonine synthase [Arabidopsis thaliana] gi|7269883|emb|CAB79742.1| threonine synthase [Arabidopsis thaliana] gi|332660284|gb|AEE85684.1| threonine synthase [Arabidopsis thaliana] Length = 526 Score = 161 bits (408), Expect = 7e-38 Identities = 73/84 (86%), Positives = 79/84 (94%) Frame = -1 Query: 254 AIEILQQFDWEVPDWVIVPGGNLGNIYAFYKGFEMCRELELVDRVPRLVCAQAANANPLY 75 AIEILQQFDW+VPDWVIVPGGNLGNIYAFYKGF+MC+EL LVDR+PR+VCAQAANANPLY Sbjct: 315 AIEILQQFDWQVPDWVIVPGGNLGNIYAFYKGFKMCQELGLVDRIPRMVCAQAANANPLY 374 Query: 74 LHYKSGWADFKPVIAEDTFASAIQ 3 LHYKSGW DFKP+ A TFASAIQ Sbjct: 375 LHYKSGWKDFKPMTASTTFASAIQ 398 >ref|XP_002514088.1| threonine synthase, putative [Ricinus communis] gi|223546544|gb|EEF48042.1| threonine synthase, putative [Ricinus communis] Length = 539 Score = 161 bits (408), Expect = 7e-38 Identities = 75/84 (89%), Positives = 78/84 (92%) Frame = -1 Query: 254 AIEILQQFDWEVPDWVIVPGGNLGNIYAFYKGFEMCRELELVDRVPRLVCAQAANANPLY 75 AIEILQQFDWEVPDWVIVPGGNLGNIYAFYKGF+MC EL LVDR+PRLVCAQAANANPLY Sbjct: 329 AIEILQQFDWEVPDWVIVPGGNLGNIYAFYKGFKMCHELGLVDRIPRLVCAQAANANPLY 388 Query: 74 LHYKSGWADFKPVIAEDTFASAIQ 3 L+YKSGW DFKPV A TFASAIQ Sbjct: 389 LYYKSGWKDFKPVKANSTFASAIQ 412 >ref|XP_006357395.1| PREDICTED: threonine synthase, chloroplastic-like [Solanum tuberosum] Length = 522 Score = 161 bits (407), Expect = 9e-38 Identities = 74/84 (88%), Positives = 78/84 (92%) Frame = -1 Query: 254 AIEILQQFDWEVPDWVIVPGGNLGNIYAFYKGFEMCRELELVDRVPRLVCAQAANANPLY 75 AIEILQQF+WEVPDWVIVPGGNLGNIYAFYKGF MC+EL LVDR+PRLVCAQAANANPLY Sbjct: 311 AIEILQQFEWEVPDWVIVPGGNLGNIYAFYKGFHMCKELGLVDRIPRLVCAQAANANPLY 370 Query: 74 LHYKSGWADFKPVIAEDTFASAIQ 3 +HYKSGW DFKPV A TFASAIQ Sbjct: 371 VHYKSGWKDFKPVKANTTFASAIQ 394 >ref|XP_004241890.1| PREDICTED: threonine synthase, chloroplastic-like [Solanum lycopersicum] Length = 522 Score = 161 bits (407), Expect = 9e-38 Identities = 74/84 (88%), Positives = 78/84 (92%) Frame = -1 Query: 254 AIEILQQFDWEVPDWVIVPGGNLGNIYAFYKGFEMCRELELVDRVPRLVCAQAANANPLY 75 AIEILQQF+WEVPDWVIVPGGNLGNIYAFYKGF MC+EL LVDR+PRLVCAQAANANPLY Sbjct: 311 AIEILQQFEWEVPDWVIVPGGNLGNIYAFYKGFHMCKELGLVDRIPRLVCAQAANANPLY 370 Query: 74 LHYKSGWADFKPVIAEDTFASAIQ 3 +HYKSGW DFKPV A TFASAIQ Sbjct: 371 VHYKSGWKDFKPVKANTTFASAIQ 394 >ref|XP_002521363.1| threonine synthase, putative [Ricinus communis] gi|223539441|gb|EEF41031.1| threonine synthase, putative [Ricinus communis] Length = 531 Score = 161 bits (407), Expect = 9e-38 Identities = 75/84 (89%), Positives = 78/84 (92%) Frame = -1 Query: 254 AIEILQQFDWEVPDWVIVPGGNLGNIYAFYKGFEMCRELELVDRVPRLVCAQAANANPLY 75 AIEILQQFDWEVPDWVIVPGGNLGNIYAFYKGF MC+EL LVDR+PRLVCAQAANANPLY Sbjct: 320 AIEILQQFDWEVPDWVIVPGGNLGNIYAFYKGFYMCKELGLVDRIPRLVCAQAANANPLY 379 Query: 74 LHYKSGWADFKPVIAEDTFASAIQ 3 L+YKSGW DFKPV A TFASAIQ Sbjct: 380 LYYKSGWKDFKPVKASSTFASAIQ 403 >gb|EXB38901.1| Threonine synthase 1 [Morus notabilis] Length = 532 Score = 160 bits (404), Expect = 2e-37 Identities = 73/84 (86%), Positives = 78/84 (92%) Frame = -1 Query: 254 AIEILQQFDWEVPDWVIVPGGNLGNIYAFYKGFEMCRELELVDRVPRLVCAQAANANPLY 75 AIEILQQFDWEVPDWVIVPGGNLGNIYAFYKGF+MC+EL LVD++PRLVCAQAANANPLY Sbjct: 320 AIEILQQFDWEVPDWVIVPGGNLGNIYAFYKGFKMCKELGLVDKIPRLVCAQAANANPLY 379 Query: 74 LHYKSGWADFKPVIAEDTFASAIQ 3 LHYKSGW +F PV A TFASAIQ Sbjct: 380 LHYKSGWKEFNPVKANSTFASAIQ 403 >ref|XP_002867385.1| methionine over-accumulator [Arabidopsis lyrata subsp. lyrata] gi|297313221|gb|EFH43644.1| methionine over-accumulator [Arabidopsis lyrata subsp. lyrata] Length = 526 Score = 159 bits (403), Expect = 3e-37 Identities = 72/84 (85%), Positives = 78/84 (92%) Frame = -1 Query: 254 AIEILQQFDWEVPDWVIVPGGNLGNIYAFYKGFEMCRELELVDRVPRLVCAQAANANPLY 75 AIEILQQFDW+VPDWVIVPGGNLGNIYAFYKGF+MC EL LVDR+PR+VCAQAANANPL+ Sbjct: 315 AIEILQQFDWQVPDWVIVPGGNLGNIYAFYKGFKMCHELGLVDRIPRMVCAQAANANPLF 374 Query: 74 LHYKSGWADFKPVIAEDTFASAIQ 3 LHYKSGW DFKP+ A TFASAIQ Sbjct: 375 LHYKSGWKDFKPMTASTTFASAIQ 398 >gb|EXB29687.1| Threonine synthase [Morus notabilis] Length = 519 Score = 159 bits (402), Expect = 4e-37 Identities = 73/84 (86%), Positives = 77/84 (91%) Frame = -1 Query: 254 AIEILQQFDWEVPDWVIVPGGNLGNIYAFYKGFEMCRELELVDRVPRLVCAQAANANPLY 75 AIEILQQFDW+VPDWVIVPGGNLGNIYAFYKGF MC+EL LVDR+PRLVCAQAANANPLY Sbjct: 310 AIEILQQFDWQVPDWVIVPGGNLGNIYAFYKGFHMCKELGLVDRIPRLVCAQAANANPLY 369 Query: 74 LHYKSGWADFKPVIAEDTFASAIQ 3 LHY SGW +FKPV A TFASAIQ Sbjct: 370 LHYNSGWKEFKPVKANTTFASAIQ 393 >ref|XP_004288966.1| PREDICTED: threonine synthase 1, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 526 Score = 159 bits (402), Expect = 4e-37 Identities = 74/84 (88%), Positives = 78/84 (92%) Frame = -1 Query: 254 AIEILQQFDWEVPDWVIVPGGNLGNIYAFYKGFEMCRELELVDRVPRLVCAQAANANPLY 75 AIEILQQFDWEVPDWVIVPGGNLGNIYAFYKGF+MC+EL LVDR+PRLVCAQAANANPLY Sbjct: 316 AIEILQQFDWEVPDWVIVPGGNLGNIYAFYKGFKMCQELGLVDRIPRLVCAQAANANPLY 375 Query: 74 LHYKSGWADFKPVIAEDTFASAIQ 3 L+YKSGW DFK V A TFASAIQ Sbjct: 376 LYYKSGWKDFKAVTANTTFASAIQ 399