BLASTX nr result
ID: Zingiber25_contig00019784
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00019784 (292 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY30144.1| Transcription factor bHLH69, putative isoform 1 [... 62 6e-08 ref|XP_006828665.1| hypothetical protein AMTR_s00129p00124210 [A... 57 2e-06 >gb|EOY30144.1| Transcription factor bHLH69, putative isoform 1 [Theobroma cacao] gi|508782889|gb|EOY30145.1| Transcription factor bHLH69, putative isoform 1 [Theobroma cacao] Length = 541 Score = 62.4 bits (150), Expect = 6e-08 Identities = 30/57 (52%), Positives = 36/57 (63%) Frame = +1 Query: 121 SSTEQTLPSEGHTTSHQMNCSSTQSQAIPTNGSGCNGVTKPRVRARRGQATDPHSIA 291 +S + P+E T + S A PT +GCNG+ KPRVRARRGQATDPHSIA Sbjct: 250 NSLYSSFPAEHQITKTMIGLPSLLQSASPTPNNGCNGIGKPRVRARRGQATDPHSIA 306 >ref|XP_006828665.1| hypothetical protein AMTR_s00129p00124210 [Amborella trichopoda] gi|548833455|gb|ERM96081.1| hypothetical protein AMTR_s00129p00124210 [Amborella trichopoda] Length = 513 Score = 57.4 bits (137), Expect = 2e-06 Identities = 29/53 (54%), Positives = 33/53 (62%), Gaps = 3/53 (5%) Frame = +1 Query: 142 PSEGHTTSHQM---NCSSTQSQAIPTNGSGCNGVTKPRVRARRGQATDPHSIA 291 P G +HQ N S +Q + G GCNG +PRVRARRGQATDPHSIA Sbjct: 275 PRTGGLPTHQQHGGNQSISQLHPVAATGGGCNGGVRPRVRARRGQATDPHSIA 327