BLASTX nr result
ID: Zingiber25_contig00019782
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00019782 (475 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006440907.1| hypothetical protein CICLE_v10024545mg [Citr... 59 5e-07 >ref|XP_006440907.1| hypothetical protein CICLE_v10024545mg [Citrus clementina] gi|557543169|gb|ESR54147.1| hypothetical protein CICLE_v10024545mg [Citrus clementina] Length = 575 Score = 59.3 bits (142), Expect = 5e-07 Identities = 23/40 (57%), Positives = 33/40 (82%) Frame = -2 Query: 156 NDFLEDCLILYIERDLTNNIDVDSIIDEVYVTKSHRAQLC 37 N+FL DC+++YIER++T+NID D+I+DE K+HR QLC Sbjct: 535 NEFLSDCIVIYIEREITDNIDSDAIVDEFSFLKNHRTQLC 574