BLASTX nr result
ID: Zingiber25_contig00018844
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00018844 (346 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517116.1| conserved hypothetical protein [Ricinus comm... 53 6e-06 >ref|XP_002517116.1| conserved hypothetical protein [Ricinus communis] gi|223543751|gb|EEF45279.1| conserved hypothetical protein [Ricinus communis] Length = 319 Score = 52.8 bits (125), Expect(2) = 6e-06 Identities = 28/65 (43%), Positives = 35/65 (53%), Gaps = 3/65 (4%) Frame = +3 Query: 6 HGPNPKTTHIFEDCIIESGSSQ---STDHVNWNCSCGDGLSSPVNDLSSFSNGCRKRTDT 176 +GPNPKTTHIF+D I+ES ST N GDG S P ++ SF C+K Sbjct: 217 YGPNPKTTHIFDDYIVESCCDVVEFSTSRTQTNGFLGDGSSYPSDNFLSFCYACKKNLGQ 276 Query: 177 GGDFH 191 G D + Sbjct: 277 GKDIY 281 Score = 22.7 bits (47), Expect(2) = 6e-06 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +1 Query: 178 EEIFMDRT*KEILLLHCHYQEMFEAKG 258 ++I+M R K C YQEM +G Sbjct: 278 KDIYMYRGEKAFCSSECRYQEMLSEEG 304