BLASTX nr result
ID: Zingiber25_contig00018589
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00018589 (292 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006827756.1| hypothetical protein AMTR_s00009p00263550 [A... 56 4e-06 >ref|XP_006827756.1| hypothetical protein AMTR_s00009p00263550 [Amborella trichopoda] gi|548832376|gb|ERM95172.1| hypothetical protein AMTR_s00009p00263550 [Amborella trichopoda] Length = 717 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = -3 Query: 290 LIAGSVGELWAVSESRVAPFSGTFQDYKKKLKAS 189 LI+GSVGELW VSE R+APF GTF DYKK +K+S Sbjct: 684 LISGSVGELWVVSEGRIAPFPGTFHDYKKIVKSS 717