BLASTX nr result
ID: Zingiber25_contig00018568
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00018568 (310 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADL36820.1| SCL domain class transcription factor [Malus dome... 63 5e-08 ref|XP_004294461.1| PREDICTED: scarecrow-like transcription fact... 62 6e-08 gb|EMJ12754.1| hypothetical protein PRUPE_ppa004136mg [Prunus pe... 62 1e-07 ref|XP_006836764.1| hypothetical protein AMTR_s00088p00161000 [A... 61 1e-07 ref|XP_002300358.2| hypothetical protein POPTR_0001s37270g [Popu... 60 2e-07 gb|AAD24405.1|AF036302_1 scarecrow-like 5 [Arabidopsis thaliana] 60 2e-07 gb|AAF87875.1|AC012561_8 Putative transcription factor [Arabidop... 60 2e-07 ref|XP_006393131.1| hypothetical protein EUTSA_v10011379mg [Eutr... 60 2e-07 ref|XP_002894262.1| hypothetical protein ARALYDRAFT_474191 [Arab... 60 2e-07 ref|NP_175475.2| scarecrow-like protein 5 [Arabidopsis thaliana]... 60 2e-07 gb|AAK59436.2| putative scarecrow protein [Arabidopsis thaliana] 60 2e-07 gb|AAK62666.1| F17J6.12/F17J6.12 [Arabidopsis thaliana] 60 2e-07 ref|XP_004293455.1| PREDICTED: scarecrow-like transcription fact... 60 3e-07 gb|EMJ16717.1| hypothetical protein PRUPE_ppa003702mg [Prunus pe... 60 4e-07 ref|XP_003544277.1| PREDICTED: scarecrow-like transcription fact... 60 4e-07 ref|XP_002529051.1| Chitin-inducible gibberellin-responsive prot... 59 5e-07 gb|ESW14496.1| hypothetical protein PHAVU_008G286000g [Phaseolus... 59 7e-07 ref|XP_003519666.1| PREDICTED: scarecrow-like transcription fact... 59 9e-07 ref|XP_003617966.1| Chitin-inducible gibberellin-responsive prot... 59 9e-07 gb|ACU20273.1| unknown [Glycine max] 59 9e-07 >gb|ADL36820.1| SCL domain class transcription factor [Malus domestica] Length = 551 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +1 Query: 1 LLQNYSEHYWLEERDGVLYLGWKNRTLVVSCAWR 102 LL+NYS+ Y LEERDG LYLGWKNR LV SCAWR Sbjct: 512 LLENYSDKYRLEERDGALYLGWKNRDLVASCAWR 545 >ref|XP_004294461.1| PREDICTED: scarecrow-like transcription factor PAT1-like isoform 1 [Fragaria vesca subsp. vesca] gi|470116589|ref|XP_004294462.1| PREDICTED: scarecrow-like transcription factor PAT1-like isoform 2 [Fragaria vesca subsp. vesca] Length = 524 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +1 Query: 1 LLQNYSEHYWLEERDGVLYLGWKNRTLVVSCAWR 102 LLQ+YSE Y LEERDG LYLGWKN+ LV SCAWR Sbjct: 491 LLQSYSEKYTLEERDGALYLGWKNQALVASCAWR 524 >gb|EMJ12754.1| hypothetical protein PRUPE_ppa004136mg [Prunus persica] gi|462407421|gb|EMJ12755.1| hypothetical protein PRUPE_ppa004136mg [Prunus persica] Length = 527 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/34 (79%), Positives = 28/34 (82%) Frame = +1 Query: 1 LLQNYSEHYWLEERDGVLYLGWKNRTLVVSCAWR 102 LLQ+YSE Y LEERDG LYLGW NR LV SCAWR Sbjct: 494 LLQSYSEKYTLEERDGALYLGWMNRVLVASCAWR 527 >ref|XP_006836764.1| hypothetical protein AMTR_s00088p00161000 [Amborella trichopoda] gi|548839324|gb|ERM99617.1| hypothetical protein AMTR_s00088p00161000 [Amborella trichopoda] Length = 558 Score = 61.2 bits (147), Expect = 1e-07 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = +1 Query: 1 LLQNYSEHYWLEERDGVLYLGWKNRTLVVSCAWR 102 LL+ Y E+Y LEE+DGVLYLGWKNR LV SCAWR Sbjct: 525 LLEGYCENYRLEEKDGVLYLGWKNRVLVASCAWR 558 >ref|XP_002300358.2| hypothetical protein POPTR_0001s37270g [Populus trichocarpa] gi|566153244|ref|XP_006369988.1| hypothetical protein POPTR_0001s37270g [Populus trichocarpa] gi|566153246|ref|XP_006369989.1| hypothetical protein POPTR_0001s37270g [Populus trichocarpa] gi|550349077|gb|EEE85163.2| hypothetical protein POPTR_0001s37270g [Populus trichocarpa] gi|550349078|gb|ERP66557.1| hypothetical protein POPTR_0001s37270g [Populus trichocarpa] gi|550349079|gb|ERP66558.1| hypothetical protein POPTR_0001s37270g [Populus trichocarpa] Length = 533 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = +1 Query: 1 LLQNYSEHYWLEERDGVLYLGWKNRTLVVSCAWR 102 LL+NYSE Y LEERDG L+LGW NR LV SCAWR Sbjct: 500 LLENYSEKYTLEERDGALFLGWMNRPLVASCAWR 533 >gb|AAD24405.1|AF036302_1 scarecrow-like 5 [Arabidopsis thaliana] Length = 306 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = +1 Query: 1 LLQNYSEHYWLEERDGVLYLGWKNRTLVVSCAWR 102 LL++YSE Y LEERDG LYLGWKN+ L+ SCAWR Sbjct: 273 LLESYSEKYTLEERDGALYLGWKNQPLITSCAWR 306 >gb|AAF87875.1|AC012561_8 Putative transcription factor [Arabidopsis thaliana] gi|12322334|gb|AAG51190.1|AC079279_11 scarecrow-like protein [Arabidopsis thaliana] Length = 526 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = +1 Query: 1 LLQNYSEHYWLEERDGVLYLGWKNRTLVVSCAWR 102 LL++YSE Y LEERDG LYLGWKN+ L+ SCAWR Sbjct: 493 LLESYSEKYTLEERDGALYLGWKNQPLITSCAWR 526 >ref|XP_006393131.1| hypothetical protein EUTSA_v10011379mg [Eutrema salsugineum] gi|312281889|dbj|BAJ33810.1| unnamed protein product [Thellungiella halophila] gi|557089709|gb|ESQ30417.1| hypothetical protein EUTSA_v10011379mg [Eutrema salsugineum] Length = 533 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = +1 Query: 1 LLQNYSEHYWLEERDGVLYLGWKNRTLVVSCAWR 102 LL++YSE Y LEERDG LYLGWKN+ L+ SCAWR Sbjct: 500 LLESYSEKYTLEERDGALYLGWKNQPLITSCAWR 533 >ref|XP_002894262.1| hypothetical protein ARALYDRAFT_474191 [Arabidopsis lyrata subsp. lyrata] gi|297340104|gb|EFH70521.1| hypothetical protein ARALYDRAFT_474191 [Arabidopsis lyrata subsp. lyrata] Length = 501 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = +1 Query: 1 LLQNYSEHYWLEERDGVLYLGWKNRTLVVSCAWR 102 LL++YSE Y LEERDG LYLGWKN+ L+ SCAWR Sbjct: 468 LLESYSEKYTLEERDGALYLGWKNQPLITSCAWR 501 >ref|NP_175475.2| scarecrow-like protein 5 [Arabidopsis thaliana] gi|75151868|sp|Q8H125.1|SCL5_ARATH RecName: Full=Scarecrow-like protein 5; Short=AtSCL5; AltName: Full=GRAS family protein 6; Short=AtGRAS-6 gi|24030207|gb|AAN41283.1| putative scarecrow protein [Arabidopsis thaliana] gi|332194447|gb|AEE32568.1| scarecrow-like protein 5 [Arabidopsis thaliana] Length = 597 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = +1 Query: 1 LLQNYSEHYWLEERDGVLYLGWKNRTLVVSCAWR 102 LL++YSE Y LEERDG LYLGWKN+ L+ SCAWR Sbjct: 564 LLESYSEKYTLEERDGALYLGWKNQPLITSCAWR 597 >gb|AAK59436.2| putative scarecrow protein [Arabidopsis thaliana] Length = 587 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = +1 Query: 1 LLQNYSEHYWLEERDGVLYLGWKNRTLVVSCAWR 102 LL++YSE Y LEERDG LYLGWKN+ L+ SCAWR Sbjct: 554 LLESYSEKYTLEERDGALYLGWKNQPLITSCAWR 587 >gb|AAK62666.1| F17J6.12/F17J6.12 [Arabidopsis thaliana] Length = 526 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = +1 Query: 1 LLQNYSEHYWLEERDGVLYLGWKNRTLVVSCAWR 102 LL++YSE Y LEERDG LYLGWKN+ L+ SCAWR Sbjct: 493 LLESYSEKYTLEERDGALYLGWKNQPLITSCAWR 526 >ref|XP_004293455.1| PREDICTED: scarecrow-like transcription factor PAT1-like [Fragaria vesca subsp. vesca] Length = 551 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = +1 Query: 1 LLQNYSEHYWLEERDGVLYLGWKNRTLVVSCAWR 102 LL+NYS+ Y L+ERDG LYLGWKNR LV SCAW+ Sbjct: 512 LLKNYSDKYRLQERDGALYLGWKNRDLVASCAWK 545 >gb|EMJ16717.1| hypothetical protein PRUPE_ppa003702mg [Prunus persica] Length = 555 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = +1 Query: 1 LLQNYSEHYWLEERDGVLYLGWKNRTLVVSCAWR 102 LL NYS+ Y L+ERDG LYLGWKNR LV SCAW+ Sbjct: 516 LLDNYSDKYRLQERDGALYLGWKNRDLVASCAWK 549 >ref|XP_003544277.1| PREDICTED: scarecrow-like transcription factor PAT1-like [Glycine max] Length = 545 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = +1 Query: 1 LLQNYSEHYWLEERDGVLYLGWKNRTLVVSCAWR 102 LL+NYS+ Y LEERDG LYLGW NR LV SCAW+ Sbjct: 512 LLENYSDRYRLEERDGALYLGWMNRDLVASCAWK 545 >ref|XP_002529051.1| Chitin-inducible gibberellin-responsive protein, putative [Ricinus communis] gi|223531531|gb|EEF33362.1| Chitin-inducible gibberellin-responsive protein, putative [Ricinus communis] Length = 538 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = +1 Query: 1 LLQNYSEHYWLEERDGVLYLGWKNRTLVVSCAWR 102 LLQ+YS+ Y LEERDG LYLGW NR L+ SCAWR Sbjct: 505 LLQSYSKKYTLEERDGALYLGWMNRPLIASCAWR 538 >gb|ESW14496.1| hypothetical protein PHAVU_008G286000g [Phaseolus vulgaris] Length = 543 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/34 (73%), Positives = 27/34 (79%) Frame = +1 Query: 1 LLQNYSEHYWLEERDGVLYLGWKNRTLVVSCAWR 102 LL+NYS Y LEERDG LYLGW NR LV SCAW+ Sbjct: 510 LLENYSNRYRLEERDGALYLGWMNRDLVASCAWK 543 >ref|XP_003519666.1| PREDICTED: scarecrow-like transcription factor PAT1-like isoformX1 [Glycine max] gi|356501711|ref|XP_003519667.1| PREDICTED: scarecrow-like transcription factor PAT1-like isoformX2 [Glycine max] gi|571442479|ref|XP_006575742.1| PREDICTED: scarecrow-like transcription factor PAT1-like isoform X3 [Glycine max] gi|571442482|ref|XP_006575743.1| PREDICTED: scarecrow-like transcription factor PAT1-like isoform X4 [Glycine max] gi|571442484|ref|XP_006575744.1| PREDICTED: scarecrow-like transcription factor PAT1-like isoform X5 [Glycine max] Length = 541 Score = 58.5 bits (140), Expect = 9e-07 Identities = 24/34 (70%), Positives = 28/34 (82%) Frame = +1 Query: 1 LLQNYSEHYWLEERDGVLYLGWKNRTLVVSCAWR 102 LL+NYS+ Y L+ERDG LYLGW NR LV SCAW+ Sbjct: 508 LLENYSDRYRLQERDGALYLGWMNRDLVASCAWK 541 >ref|XP_003617966.1| Chitin-inducible gibberellin-responsive protein [Medicago truncatula] gi|355519301|gb|AET00925.1| Chitin-inducible gibberellin-responsive protein [Medicago truncatula] Length = 544 Score = 58.5 bits (140), Expect = 9e-07 Identities = 24/34 (70%), Positives = 28/34 (82%) Frame = +1 Query: 1 LLQNYSEHYWLEERDGVLYLGWKNRTLVVSCAWR 102 LL+NYS+ Y L+ERDG LYLGW NR LV SCAW+ Sbjct: 511 LLENYSDRYRLQERDGALYLGWMNRDLVASCAWK 544 >gb|ACU20273.1| unknown [Glycine max] Length = 348 Score = 58.5 bits (140), Expect = 9e-07 Identities = 24/34 (70%), Positives = 28/34 (82%) Frame = +1 Query: 1 LLQNYSEHYWLEERDGVLYLGWKNRTLVVSCAWR 102 LL+NYS+ Y L+ERDG LYLGW NR LV SCAW+ Sbjct: 315 LLENYSDRYRLQERDGALYLGWMNRDLVASCAWK 348