BLASTX nr result
ID: Zingiber25_contig00018316
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00018316 (431 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ESW19168.1| hypothetical protein PHAVU_006G102100g [Phaseolus... 73 5e-11 gb|EMJ25009.1| hypothetical protein PRUPE_ppa010698mg [Prunus pe... 73 5e-11 ref|XP_006650321.1| PREDICTED: auxin-responsive protein IAA11-li... 72 1e-10 ref|XP_004288427.1| PREDICTED: auxin-responsive protein IAA14-li... 72 1e-10 gb|AFS44507.1| auxin repressor, partial [Fragaria x ananassa] 72 1e-10 ref|NP_001266039.1| IAA7 protein [Solanum lycopersicum] gi|36581... 72 1e-10 ref|NP_001275031.1| auxin-responsive protein IAA14-like [Solanum... 72 1e-10 ref|XP_006664171.1| PREDICTED: auxin-responsive protein IAA30-li... 71 1e-10 ref|XP_004963100.1| PREDICTED: auxin-responsive protein IAA30-li... 71 1e-10 gb|EOY11069.1| Indoleacetic acid-induced protein 16 [Theobroma c... 71 1e-10 ref|XP_004495392.1| PREDICTED: auxin-responsive protein IAA14-li... 71 1e-10 ref|XP_004302055.1| PREDICTED: auxin-responsive protein IAA16-li... 71 1e-10 gb|AAD32146.1|AF123508_1 Nt-iaa28 deduced protein [Nicotiana tab... 71 1e-10 gb|AAD32147.1|AF123509_1 Nt-iaa4.1 deduced protein [Nicotiana ta... 71 1e-10 ref|NP_001067209.1| Os12g0601300 [Oryza sativa Japonica Group] g... 71 1e-10 gb|AEE25654.1| auxin-responsive protein [Gossypium hirsutum] 71 1e-10 ref|NP_001266049.1| IAA9 protein [Solanum lycopersicum] gi|36581... 71 1e-10 ref|XP_003579189.1| PREDICTED: auxin-responsive protein IAA30-li... 71 1e-10 dbj|BAK01326.1| predicted protein [Hordeum vulgare subsp. vulgare] 71 1e-10 dbj|BAJ84870.1| predicted protein [Hordeum vulgare subsp. vulgar... 71 1e-10 >gb|ESW19168.1| hypothetical protein PHAVU_006G102100g [Phaseolus vulgaris] Length = 272 Score = 72.8 bits (177), Expect = 5e-11 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = -2 Query: 430 VPWEMFVDSCKRLRIMKGSEAIGIAPRAMEKRKNRS 323 VPWEMFV+SCKRLRIMKGSEAIG+APRA+EKRKNRS Sbjct: 237 VPWEMFVESCKRLRIMKGSEAIGLAPRAVEKRKNRS 272 >gb|EMJ25009.1| hypothetical protein PRUPE_ppa010698mg [Prunus persica] Length = 239 Score = 72.8 bits (177), Expect = 5e-11 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -2 Query: 430 VPWEMFVDSCKRLRIMKGSEAIGIAPRAMEKRKNRS 323 VPWEMFVDSCKRLRIMKGSEAIG+APRAMEK KNRS Sbjct: 204 VPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKNRS 239 >ref|XP_006650321.1| PREDICTED: auxin-responsive protein IAA11-like [Oryza brachyantha] Length = 237 Score = 71.6 bits (174), Expect = 1e-10 Identities = 32/36 (88%), Positives = 36/36 (100%) Frame = -2 Query: 430 VPWEMFVDSCKRLRIMKGSEAIGIAPRAMEKRKNRS 323 VPW+MFVDSCKRLRIMKGSEAIG+APRAMEKRK+R+ Sbjct: 202 VPWDMFVDSCKRLRIMKGSEAIGLAPRAMEKRKSRN 237 >ref|XP_004288427.1| PREDICTED: auxin-responsive protein IAA14-like [Fragaria vesca subsp. vesca] Length = 238 Score = 71.6 bits (174), Expect = 1e-10 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -2 Query: 430 VPWEMFVDSCKRLRIMKGSEAIGIAPRAMEKRKNRS 323 VPWEMFVDSCKRLRIMKGSEAIG+AP+AMEK KNRS Sbjct: 203 VPWEMFVDSCKRLRIMKGSEAIGLAPKAMEKCKNRS 238 >gb|AFS44507.1| auxin repressor, partial [Fragaria x ananassa] Length = 231 Score = 71.6 bits (174), Expect = 1e-10 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -2 Query: 430 VPWEMFVDSCKRLRIMKGSEAIGIAPRAMEKRKNRS 323 VPWEMFVDSCKRLRIMKGSEAIG+AP+AMEK KNRS Sbjct: 196 VPWEMFVDSCKRLRIMKGSEAIGLAPKAMEKCKNRS 231 >ref|NP_001266039.1| IAA7 protein [Solanum lycopersicum] gi|365818525|gb|AEX00351.1| IAA7 [Solanum lycopersicum] Length = 218 Score = 71.6 bits (174), Expect = 1e-10 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -2 Query: 430 VPWEMFVDSCKRLRIMKGSEAIGIAPRAMEKRKNRS 323 VPW+MFVDSCKRLRIMKGSEAIG+APRAMEK KNRS Sbjct: 183 VPWQMFVDSCKRLRIMKGSEAIGLAPRAMEKCKNRS 218 >ref|NP_001275031.1| auxin-responsive protein IAA14-like [Solanum tuberosum] gi|117573699|gb|ABK41009.1| auxin/indole-3-acetic acid [Solanum tuberosum] Length = 213 Score = 71.6 bits (174), Expect = 1e-10 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -2 Query: 430 VPWEMFVDSCKRLRIMKGSEAIGIAPRAMEKRKNRS 323 VPW+MFVDSCKRLRIMKGSEAIG+APRAMEK KNRS Sbjct: 178 VPWQMFVDSCKRLRIMKGSEAIGLAPRAMEKCKNRS 213 >ref|XP_006664171.1| PREDICTED: auxin-responsive protein IAA30-like [Oryza brachyantha] Length = 248 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -2 Query: 430 VPWEMFVDSCKRLRIMKGSEAIGIAPRAMEKRKNRS 323 VPWEMFV+SCKRLRIMKGSEAIG+APRAMEK KNRS Sbjct: 213 VPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS 248 >ref|XP_004963100.1| PREDICTED: auxin-responsive protein IAA30-like [Setaria italica] Length = 264 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -2 Query: 430 VPWEMFVDSCKRLRIMKGSEAIGIAPRAMEKRKNRS 323 VPWEMFV+SCKRLRIMKGSEAIG+APRAMEK KNRS Sbjct: 229 VPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS 264 >gb|EOY11069.1| Indoleacetic acid-induced protein 16 [Theobroma cacao] Length = 249 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -2 Query: 430 VPWEMFVDSCKRLRIMKGSEAIGIAPRAMEKRKNRS 323 VPWEMFVDSCKRLRIMKGSEAIG+APRA+EK KNRS Sbjct: 214 VPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 249 >ref|XP_004495392.1| PREDICTED: auxin-responsive protein IAA14-like isoform X2 [Cicer arietinum] Length = 240 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -2 Query: 430 VPWEMFVDSCKRLRIMKGSEAIGIAPRAMEKRKNRS 323 VPWEMFV+SCKRLRIMKGSEAIG+APRAMEK KNRS Sbjct: 205 VPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS 240 >ref|XP_004302055.1| PREDICTED: auxin-responsive protein IAA16-like [Fragaria vesca subsp. vesca] Length = 254 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -2 Query: 430 VPWEMFVDSCKRLRIMKGSEAIGIAPRAMEKRKNRS 323 VPWEMFVDSCKRLRIMKGSEAIG+APRA+EK KNRS Sbjct: 219 VPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKFKNRS 254 >gb|AAD32146.1|AF123508_1 Nt-iaa28 deduced protein [Nicotiana tabacum] Length = 240 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -2 Query: 430 VPWEMFVDSCKRLRIMKGSEAIGIAPRAMEKRKNRS 323 VPWEMFVDSCKRLRIMKGSEAIG+APRA+EK KNRS Sbjct: 205 VPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 240 >gb|AAD32147.1|AF123509_1 Nt-iaa4.1 deduced protein [Nicotiana tabacum] Length = 220 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -2 Query: 430 VPWEMFVDSCKRLRIMKGSEAIGIAPRAMEKRKNRS 323 VPWEMFVDSCKRLRIMKGSEAIG+APRA+EK KNRS Sbjct: 185 VPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 220 >ref|NP_001067209.1| Os12g0601300 [Oryza sativa Japonica Group] gi|88911337|sp|P0C132.1|IAA30_ORYSJ RecName: Full=Auxin-responsive protein IAA30; AltName: Full=Indoleacetic acid-induced protein 30 gi|77556997|gb|ABA99793.1| Auxin-induced protein AUX28, putative, expressed [Oryza sativa Japonica Group] gi|113649716|dbj|BAF30228.1| Os12g0601300 [Oryza sativa Japonica Group] gi|125537297|gb|EAY83785.1| hypothetical protein OsI_39001 [Oryza sativa Indica Group] gi|215686933|dbj|BAG90803.1| unnamed protein product [Oryza sativa Japonica Group] Length = 277 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -2 Query: 430 VPWEMFVDSCKRLRIMKGSEAIGIAPRAMEKRKNRS 323 VPWEMFV+SCKRLRIMKGSEAIG+APRAMEK KNRS Sbjct: 242 VPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS 277 >gb|AEE25654.1| auxin-responsive protein [Gossypium hirsutum] Length = 246 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -2 Query: 430 VPWEMFVDSCKRLRIMKGSEAIGIAPRAMEKRKNRS 323 VPWEMFVDSCKRLRIMKGSEAIG+APRA+EK KNRS Sbjct: 211 VPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 246 >ref|NP_001266049.1| IAA9 protein [Solanum lycopersicum] gi|365818541|gb|AEX00359.1| IAA16 [Solanum lycopersicum] Length = 251 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -2 Query: 430 VPWEMFVDSCKRLRIMKGSEAIGIAPRAMEKRKNRS 323 VPWEMFVDSCKRLRIMKGSEAIG+APRA+EK KNRS Sbjct: 216 VPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 251 >ref|XP_003579189.1| PREDICTED: auxin-responsive protein IAA30-like [Brachypodium distachyon] Length = 249 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -2 Query: 430 VPWEMFVDSCKRLRIMKGSEAIGIAPRAMEKRKNRS 323 VPWEMFV+SCKRLRIMKGSEAIG+APRAMEK KNRS Sbjct: 214 VPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS 249 >dbj|BAK01326.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 252 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -2 Query: 430 VPWEMFVDSCKRLRIMKGSEAIGIAPRAMEKRKNRS 323 VPWEMFV+SCKRLRIMKGSEAIG+APRAMEK KNRS Sbjct: 217 VPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS 252 >dbj|BAJ84870.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326516486|dbj|BAJ92398.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 252 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -2 Query: 430 VPWEMFVDSCKRLRIMKGSEAIGIAPRAMEKRKNRS 323 VPWEMFV+SCKRLRIMKGSEAIG+APRAMEK KNRS Sbjct: 217 VPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS 252