BLASTX nr result
ID: Zingiber25_contig00018264
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00018264 (338 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|P37118.1|C71A2_SOLME RecName: Full=Cytochrome P450 71A2; AltN... 56 4e-06 gb|EMJ11828.1| hypothetical protein PRUPE_ppa019660mg [Prunus pe... 56 6e-06 gb|EMJ11105.1| hypothetical protein PRUPE_ppa004281mg [Prunus pe... 56 6e-06 >sp|P37118.1|C71A2_SOLME RecName: Full=Cytochrome P450 71A2; AltName: Full=CYPLXXIA2; AltName: Full=Cytochrome P-450EG4 gi|408140|emb|CAA50645.1| P450 hydroxylase [Solanum melongena] gi|441185|dbj|BAA03635.1| Cytochrome P-450EG4 [Solanum melongena] Length = 505 Score = 56.2 bits (134), Expect = 4e-06 Identities = 29/51 (56%), Positives = 38/51 (74%), Gaps = 3/51 (5%) Frame = -3 Query: 336 IAVIELGLATLMHKFEWKLHEG---EEMEMSEVFGITMRKKRTLQLVATPC 193 IAVIEL LA L+HKF++ L EG E+++M+E GIT R+K L +VATPC Sbjct: 455 IAVIELALARLVHKFDFALPEGIKPEDLDMTETIGITTRRKLPLLVVATPC 505 >gb|EMJ11828.1| hypothetical protein PRUPE_ppa019660mg [Prunus persica] Length = 519 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/40 (60%), Positives = 32/40 (80%) Frame = -3 Query: 315 LATLMHKFEWKLHEGEEMEMSEVFGITMRKKRTLQLVATP 196 LATL+H F+WKL +GEE+++SE FGI M+KK L L+ TP Sbjct: 471 LATLLHSFDWKLPQGEELDLSEKFGIVMKKKIPLVLIPTP 510 >gb|EMJ11105.1| hypothetical protein PRUPE_ppa004281mg [Prunus persica] Length = 518 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/40 (60%), Positives = 32/40 (80%) Frame = -3 Query: 315 LATLMHKFEWKLHEGEEMEMSEVFGITMRKKRTLQLVATP 196 LATL+H F+WKL +GEE+++SE FGI M+KK L L+ TP Sbjct: 470 LATLLHSFDWKLPQGEELDLSEKFGIVMKKKIPLVLIPTP 509