BLASTX nr result
ID: Zingiber25_contig00016607
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00016607 (277 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002458175.1| hypothetical protein SORBIDRAFT_03g028240 [S... 60 3e-07 ref|XP_004969197.1| PREDICTED: probable indole-3-acetic acid-ami... 57 2e-06 gb|AFW83298.1| hypothetical protein ZEAMMB73_392922 [Zea mays] 55 7e-06 ref|NP_001167813.1| hypothetical protein [Zea mays] gi|223944151... 55 7e-06 >ref|XP_002458175.1| hypothetical protein SORBIDRAFT_03g028240 [Sorghum bicolor] gi|241930150|gb|EES03295.1| hypothetical protein SORBIDRAFT_03g028240 [Sorghum bicolor] Length = 611 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -1 Query: 277 KTPRFVGQSNIKVLQILNRNVTECYFSTAYGI 182 KTPRFV QSN KVLQIL+RNVT+CYFSTAYG+ Sbjct: 580 KTPRFVSQSNSKVLQILSRNVTQCYFSTAYGL 611 >ref|XP_004969197.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.5-like isoform X1 [Setaria italica] gi|514778832|ref|XP_004969198.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.5-like isoform X2 [Setaria italica] Length = 582 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -1 Query: 277 KTPRFVGQSNIKVLQILNRNVTECYFSTAYGI 182 KTPRFV QSN KVLQILNRNVT+ YFS+AYGI Sbjct: 551 KTPRFVSQSNSKVLQILNRNVTQSYFSSAYGI 582 >gb|AFW83298.1| hypothetical protein ZEAMMB73_392922 [Zea mays] Length = 186 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -1 Query: 277 KTPRFVGQSNIKVLQILNRNVTECYFSTAYGI 182 KTPRFV QSN KVLQIL+RNVT YFSTAYG+ Sbjct: 155 KTPRFVSQSNSKVLQILSRNVTRSYFSTAYGL 186 >ref|NP_001167813.1| hypothetical protein [Zea mays] gi|223944151|gb|ACN26159.1| unknown [Zea mays] gi|413950650|gb|AFW83299.1| hypothetical protein ZEAMMB73_392922 [Zea mays] Length = 583 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -1 Query: 277 KTPRFVGQSNIKVLQILNRNVTECYFSTAYGI 182 KTPRFV QSN KVLQIL+RNVT YFSTAYG+ Sbjct: 552 KTPRFVSQSNSKVLQILSRNVTRSYFSTAYGL 583