BLASTX nr result
ID: Zingiber25_contig00016282
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00016282 (389 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004145727.1| PREDICTED: uncharacterized protein LOC101212... 42 2e-06 >ref|XP_004145727.1| PREDICTED: uncharacterized protein LOC101212001 [Cucumis sativus] Length = 2598 Score = 42.4 bits (98), Expect(2) = 2e-06 Identities = 21/59 (35%), Positives = 37/59 (62%), Gaps = 2/59 (3%) Frame = -2 Query: 220 RGARRLKHNNLKATWDESLLSESETEQYLGLALTSSYQEDDQSTFEMSIE--SSDEIFK 50 + +++ K +KATWD+S SESE E+ L L + +DD+ ++++E S DE+F+ Sbjct: 1278 KSSKKSKKKAMKATWDDSSESESEVEEMANLGLMAHSDKDDEHDDKVTLEPLSIDELFE 1336 Score = 35.0 bits (79), Expect(2) = 2e-06 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = -3 Query: 309 KQRNVWCYNCQEEGHIKDNCPKLKTKRR 226 K+ V CY C+ GHI+ +CP LK+ ++ Sbjct: 1255 KKDEVICYECKRSGHIRTDCPLLKSSKK 1282