BLASTX nr result
ID: Zingiber25_contig00016119
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00016119 (1064 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAJ26376.1| putative WRKY DNA-binding protein [Brachypodium ... 60 2e-06 ref|XP_003578307.1| PREDICTED: probable WRKY transcription facto... 60 2e-06 >emb|CAJ26376.1| putative WRKY DNA-binding protein [Brachypodium sylvaticum] Length = 687 Score = 59.7 bits (143), Expect = 2e-06 Identities = 39/103 (37%), Positives = 51/103 (49%), Gaps = 16/103 (15%) Frame = +1 Query: 802 MAGAEDKVGVINDWSF--PNPSPRTFMSNFLSEDFGSRSFTDSFQGN---------ENEG 948 MAG D+ ++ DW P PSPRT MS+FL+EDF S F++ F N E G Sbjct: 1 MAGTSDRGSIMEDWMAMPPTPSPRTLMSSFLNEDFSSGPFSNLFSENGSNKPHDHSEKRG 60 Query: 949 ----LPRALEVDSVDRVYEDYLSFEPNWSGAH-NPNMHGNLAE 1062 L + S + + +S EPN A+ PN HG LAE Sbjct: 61 EFVDLRDQVPAQSAEATLQKDISLEPNLFNANQKPNPHGGLAE 103 >ref|XP_003578307.1| PREDICTED: probable WRKY transcription factor 2-like [Brachypodium distachyon] Length = 625 Score = 59.7 bits (143), Expect = 2e-06 Identities = 39/103 (37%), Positives = 51/103 (49%), Gaps = 16/103 (15%) Frame = +1 Query: 802 MAGAEDKVGVINDWSF--PNPSPRTFMSNFLSEDFGSRSFTDSFQGN---------ENEG 948 MAG D+ ++ DW P PSPRT MS+FL+EDF S F++ F N E G Sbjct: 1 MAGTSDRGSIMEDWMAMPPTPSPRTLMSSFLNEDFSSGPFSNLFSENGSNKPHDHSEKRG 60 Query: 949 ----LPRALEVDSVDRVYEDYLSFEPNWSGAH-NPNMHGNLAE 1062 L + S + + +S EPN A+ PN HG LAE Sbjct: 61 EFVDLRDQVPAQSAEATLQKDISLEPNLFNANQKPNPHGGLAE 103