BLASTX nr result
ID: Zingiber25_contig00015978
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00015978 (263 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006847757.1| hypothetical protein AMTR_s00162p00029070 [A... 61 2e-07 >ref|XP_006847757.1| hypothetical protein AMTR_s00162p00029070 [Amborella trichopoda] gi|548851058|gb|ERN09338.1| hypothetical protein AMTR_s00162p00029070 [Amborella trichopoda] Length = 433 Score = 60.8 bits (146), Expect = 2e-07 Identities = 32/70 (45%), Positives = 46/70 (65%) Frame = -3 Query: 210 MATNQIFVKFLDGRTRCLQIPSPTVSGEALRRDIVTRTGIPLRYLRVVSGIREXXXXXXX 31 MAT+QI V+ LDG+TRC+QI +P ++G +L+ I RTGIP+ + R+V+G E Sbjct: 1 MATHQILVRLLDGQTRCIQIENPRITGSSLKNLIRERTGIPVPFQRLVAGALE-ISETSL 59 Query: 30 XXXXDGLFPS 1 +GLFPS Sbjct: 60 LSSINGLFPS 69