BLASTX nr result
ID: Zingiber25_contig00015742
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00015742 (468 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN81423.1| hypothetical protein VITISV_035943 [Vitis vinifera] 59 9e-07 ref|XP_003608034.1| hypothetical protein MTR_4g086780 [Medicago ... 57 2e-06 ref|XP_004505185.1| PREDICTED: uncharacterized protein LOC101490... 57 3e-06 ref|XP_006384448.1| hypothetical protein POPTR_0004s15180g [Popu... 57 3e-06 ref|XP_002521845.1| conserved hypothetical protein [Ricinus comm... 57 3e-06 ref|XP_002330279.1| predicted protein [Populus trichocarpa] 57 3e-06 ref|XP_004230799.1| PREDICTED: uncharacterized protein LOC101244... 56 4e-06 gb|EOX98188.1| Uncharacterized protein TCM_007002 [Theobroma cacao] 56 6e-06 ref|XP_002510275.1| conserved hypothetical protein [Ricinus comm... 55 7e-06 gb|EMJ26202.1| hypothetical protein PRUPE_ppa020468mg, partial [... 55 1e-05 >emb|CAN81423.1| hypothetical protein VITISV_035943 [Vitis vinifera] Length = 941 Score = 58.5 bits (140), Expect = 9e-07 Identities = 22/37 (59%), Positives = 30/37 (81%) Frame = -2 Query: 275 RLCSGRSILGYGRYDLHGWIERKCATCVGGRPDSARR 165 RLCSGR I+G+G+YD+ GW+ERKC++C+ GR D R Sbjct: 863 RLCSGRRIMGHGQYDVEGWVERKCSSCIDGRVDPPPR 899 >ref|XP_003608034.1| hypothetical protein MTR_4g086780 [Medicago truncatula] gi|355509089|gb|AES90231.1| hypothetical protein MTR_4g086780 [Medicago truncatula] Length = 131 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/54 (46%), Positives = 32/54 (59%), Gaps = 2/54 (3%) Frame = -2 Query: 275 RLCSGRSILGYGRYDLHGWIERKCATCVGGR--PDSARRQSAHGAGRTEEEKPA 120 RLCSGR ++GYG YD+ W+E KC++CVGGR P R + E PA Sbjct: 51 RLCSGRRVMGYGEYDIESWVETKCSSCVGGRIVPPPPPRPPVNEPEAAAENSPA 104 >ref|XP_004505185.1| PREDICTED: uncharacterized protein LOC101490954 [Cicer arietinum] Length = 129 Score = 57.0 bits (136), Expect = 3e-06 Identities = 20/31 (64%), Positives = 27/31 (87%) Frame = -2 Query: 275 RLCSGRSILGYGRYDLHGWIERKCATCVGGR 183 RLCSGR ++GYG+YD+ W+E KC++CVGGR Sbjct: 54 RLCSGRRVMGYGQYDIESWVETKCSSCVGGR 84 >ref|XP_006384448.1| hypothetical protein POPTR_0004s15180g [Populus trichocarpa] gi|550341066|gb|ERP62245.1| hypothetical protein POPTR_0004s15180g [Populus trichocarpa] Length = 135 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/62 (45%), Positives = 35/62 (56%), Gaps = 2/62 (3%) Frame = -2 Query: 275 RLCSGRSILGYGRYDLHGWIERKCATCVGGR--PDSARRQSAHGAGRTEEEKPAAGRPEI 102 RLCSGR ILG+G+YD GW+ERKC++C+ G P R A EE P + E Sbjct: 59 RLCSGRRILGHGQYDFEGWVERKCSSCLDGHVDPPPTRHADIPVAAPVVEEGPQEIKEEE 118 Query: 101 TE 96 E Sbjct: 119 QE 120 >ref|XP_002521845.1| conserved hypothetical protein [Ricinus communis] gi|223538883|gb|EEF40481.1| conserved hypothetical protein [Ricinus communis] Length = 129 Score = 56.6 bits (135), Expect = 3e-06 Identities = 20/33 (60%), Positives = 28/33 (84%) Frame = -2 Query: 275 RLCSGRSILGYGRYDLHGWIERKCATCVGGRPD 177 RLCSGR ++G+G+YD GW+ERKC++C+ GR D Sbjct: 53 RLCSGRRVMGHGQYDFEGWVERKCSSCLDGRVD 85 >ref|XP_002330279.1| predicted protein [Populus trichocarpa] Length = 133 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/62 (45%), Positives = 35/62 (56%), Gaps = 2/62 (3%) Frame = -2 Query: 275 RLCSGRSILGYGRYDLHGWIERKCATCVGGR--PDSARRQSAHGAGRTEEEKPAAGRPEI 102 RLCSGR ILG+G+YD GW+ERKC++C+ G P R A EE P + E Sbjct: 57 RLCSGRRILGHGQYDFEGWVERKCSSCLDGHVDPPPTRHADIPVAAPVVEEGPQEIKEEE 116 Query: 101 TE 96 E Sbjct: 117 QE 118 >ref|XP_004230799.1| PREDICTED: uncharacterized protein LOC101244813 [Solanum lycopersicum] Length = 149 Score = 56.2 bits (134), Expect = 4e-06 Identities = 23/40 (57%), Positives = 28/40 (70%) Frame = -2 Query: 275 RLCSGRSILGYGRYDLHGWIERKCATCVGGRPDSARRQSA 156 RLCSGR I+G G+YD GW+E KCA+C+ GR D R A Sbjct: 56 RLCSGRKIMGRGQYDFEGWVETKCASCIDGRVDPIPRPVA 95 >gb|EOX98188.1| Uncharacterized protein TCM_007002 [Theobroma cacao] Length = 138 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/60 (45%), Positives = 36/60 (60%) Frame = -2 Query: 275 RLCSGRSILGYGRYDLHGWIERKCATCVGGRPDSARRQSAHGAGRTEEEKPAAGRPEITE 96 RLCSGR I+G+G+YD GW+ERKC++C+ GR + R EE P A E T+ Sbjct: 61 RLCSGRPIMGHGQYDFEGWVERKCSSCLDGRVNPP-------PPRPTEEVPVAVPAEDTQ 113 >ref|XP_002510275.1| conserved hypothetical protein [Ricinus communis] gi|223550976|gb|EEF52462.1| conserved hypothetical protein [Ricinus communis] Length = 121 Score = 55.5 bits (132), Expect = 7e-06 Identities = 23/39 (58%), Positives = 28/39 (71%) Frame = -2 Query: 275 RLCSGRSILGYGRYDLHGWIERKCATCVGGRPDSARRQS 159 RLCSGR ILGYG+YD+ W E KCA+C+ GR S +S Sbjct: 50 RLCSGRRILGYGQYDIESWAETKCASCIDGRISSPAPRS 88 >gb|EMJ26202.1| hypothetical protein PRUPE_ppa020468mg, partial [Prunus persica] Length = 118 Score = 55.1 bits (131), Expect = 1e-05 Identities = 21/31 (67%), Positives = 25/31 (80%) Frame = -2 Query: 275 RLCSGRSILGYGRYDLHGWIERKCATCVGGR 183 RLCSGRSI+GYG YDL W E KC++C+ GR Sbjct: 44 RLCSGRSIIGYGHYDLESWAETKCSSCIDGR 74