BLASTX nr result
ID: Zingiber25_contig00015139
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00015139 (431 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC31777.1| hypothetical protein L484_020601 [Morus notabilis] 55 1e-05 >gb|EXC31777.1| hypothetical protein L484_020601 [Morus notabilis] Length = 143 Score = 55.1 bits (131), Expect = 1e-05 Identities = 34/80 (42%), Positives = 43/80 (53%), Gaps = 4/80 (5%) Frame = +2 Query: 167 MFSFRAPS*SKQEGGMGK--GVLRSAARALSW--PRGSKTTCSAEVPEDVKEGEFAVVAV 334 M FR S S G K + R+L PR S + + VP+DVKEG FAV+AV Sbjct: 1 MAKFRGASSSSSSSGKKKINSIAEKLQRSLYLVKPRPSSSNDTNAVPQDVKEGHFAVIAV 60 Query: 335 WNEEATRFVASLSCLSNPVF 394 +E RFV LSCL++P F Sbjct: 61 KGDEPKRFVVPLSCLAHPTF 80