BLASTX nr result
ID: Zingiber25_contig00014904
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00014904 (278 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABF70013.1| myb DNA-binding domain-containing protein [Musa a... 66 4e-09 >gb|ABF70013.1| myb DNA-binding domain-containing protein [Musa acuminata] Length = 375 Score = 66.2 bits (160), Expect = 4e-09 Identities = 33/52 (63%), Positives = 37/52 (71%), Gaps = 1/52 (1%) Frame = -2 Query: 154 DHSDSGSGRTKRAGRAPSLTSGAHLSLQ-LQHPLRKARRCWSPELHRRFVLA 2 +H G +K GRAP +GAHLSLQ +Q RKARRCWSPELHRRFVLA Sbjct: 210 EHQAGGVSGSKGVGRAPPAMTGAHLSLQVMQQTPRKARRCWSPELHRRFVLA 261