BLASTX nr result
ID: Zingiber25_contig00014486
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00014486 (280 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006407741.1| hypothetical protein EUTSA_v10022036mg [Eutr... 62 8e-08 ref|XP_006299627.1| hypothetical protein CARUB_v10015806mg [Caps... 62 8e-08 ref|NP_187491.1| ENTH/VHS/GAT family protein [Arabidopsis thalia... 62 8e-08 ref|XP_002882583.1| VHS domain-containing protein [Arabidopsis l... 62 8e-08 ref|XP_006476080.1| PREDICTED: ADP-ribosylation factor-binding p... 61 2e-07 ref|XP_006450645.1| hypothetical protein CICLE_v10007656mg [Citr... 61 2e-07 ref|XP_006833334.1| hypothetical protein AMTR_s00109p00078110 [A... 61 2e-07 gb|AFW70949.1| putative VHS/GAT domain containing family protein... 60 2e-07 ref|NP_001147567.1| VHS and GAT domain protein [Zea mays] gi|195... 60 2e-07 ref|XP_006643942.1| PREDICTED: TOM1-like protein 1-like [Oryza b... 60 3e-07 gb|EMT25957.1| TOM1-like protein 2 [Aegilops tauschii] 60 3e-07 gb|EXB82271.1| Protein PEROXIN-4 [Morus notabilis] 59 5e-07 gb|ESW33366.1| hypothetical protein PHAVU_001G063400g [Phaseolus... 59 5e-07 ref|XP_004952188.1| PREDICTED: target of Myb protein 1-like [Set... 59 5e-07 ref|XP_004498477.1| PREDICTED: TOM1-like protein 1-like [Cicer a... 59 5e-07 ref|NP_001237269.1| VHS and GAT domain protein [Glycine max] gi|... 59 5e-07 ref|XP_003631826.1| PREDICTED: uncharacterized protein LOC100249... 59 5e-07 ref|XP_003544671.1| PREDICTED: TOM1-like protein 2-like [Glycine... 59 5e-07 ref|XP_002284083.2| PREDICTED: uncharacterized protein LOC100249... 59 5e-07 ref|XP_002453673.1| hypothetical protein SORBIDRAFT_04g010220 [S... 59 5e-07 >ref|XP_006407741.1| hypothetical protein EUTSA_v10022036mg [Eutrema salsugineum] gi|557108887|gb|ESQ49194.1| hypothetical protein EUTSA_v10022036mg [Eutrema salsugineum] Length = 609 Score = 62.0 bits (149), Expect = 8e-08 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +3 Query: 180 MAGALVDRATSDMLVGPDWSINLEICDVLNHEP 278 M LVDRATSDML+GPDW++NLEICD+LNHEP Sbjct: 1 MVHPLVDRATSDMLIGPDWAMNLEICDMLNHEP 33 >ref|XP_006299627.1| hypothetical protein CARUB_v10015806mg [Capsella rubella] gi|482568336|gb|EOA32525.1| hypothetical protein CARUB_v10015806mg [Capsella rubella] Length = 613 Score = 62.0 bits (149), Expect = 8e-08 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +3 Query: 180 MAGALVDRATSDMLVGPDWSINLEICDVLNHEP 278 M LVDRATSDML+GPDW++NLEICD+LNHEP Sbjct: 1 MVHPLVDRATSDMLIGPDWAMNLEICDMLNHEP 33 >ref|NP_187491.1| ENTH/VHS/GAT family protein [Arabidopsis thaliana] gi|12322744|gb|AAG51368.1|AC012562_29 hypothetical protein; 78804-81924 [Arabidopsis thaliana] gi|332641159|gb|AEE74680.1| ENTH/VHS/GAT family protein [Arabidopsis thaliana] Length = 607 Score = 62.0 bits (149), Expect = 8e-08 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +3 Query: 180 MAGALVDRATSDMLVGPDWSINLEICDVLNHEP 278 M LVDRATSDML+GPDW++NLEICD+LNHEP Sbjct: 1 MVHPLVDRATSDMLIGPDWAMNLEICDMLNHEP 33 >ref|XP_002882583.1| VHS domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297328423|gb|EFH58842.1| VHS domain-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 604 Score = 62.0 bits (149), Expect = 8e-08 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +3 Query: 180 MAGALVDRATSDMLVGPDWSINLEICDVLNHEP 278 M LVDRATSDML+GPDW++NLEICD+LNHEP Sbjct: 1 MVHPLVDRATSDMLIGPDWAMNLEICDMLNHEP 33 >ref|XP_006476080.1| PREDICTED: ADP-ribosylation factor-binding protein GGA3-like [Citrus sinensis] Length = 676 Score = 60.8 bits (146), Expect = 2e-07 Identities = 23/33 (69%), Positives = 31/33 (93%) Frame = +3 Query: 180 MAGALVDRATSDMLVGPDWSINLEICDVLNHEP 278 M ++VDRATSDML+GPDW++N+EICD+LNH+P Sbjct: 1 MVNSMVDRATSDMLIGPDWAMNIEICDMLNHDP 33 >ref|XP_006450645.1| hypothetical protein CICLE_v10007656mg [Citrus clementina] gi|557553871|gb|ESR63885.1| hypothetical protein CICLE_v10007656mg [Citrus clementina] Length = 676 Score = 60.8 bits (146), Expect = 2e-07 Identities = 23/33 (69%), Positives = 31/33 (93%) Frame = +3 Query: 180 MAGALVDRATSDMLVGPDWSINLEICDVLNHEP 278 M ++VDRATSDML+GPDW++N+EICD+LNH+P Sbjct: 1 MVNSMVDRATSDMLIGPDWAMNIEICDMLNHDP 33 >ref|XP_006833334.1| hypothetical protein AMTR_s00109p00078110 [Amborella trichopoda] gi|548838010|gb|ERM98612.1| hypothetical protein AMTR_s00109p00078110 [Amborella trichopoda] Length = 617 Score = 60.8 bits (146), Expect = 2e-07 Identities = 23/33 (69%), Positives = 31/33 (93%) Frame = +3 Query: 180 MAGALVDRATSDMLVGPDWSINLEICDVLNHEP 278 M +LV+RATSDML+GPDW++N+EICD+LNH+P Sbjct: 1 MVNSLVERATSDMLIGPDWAMNIEICDILNHDP 33 >gb|AFW70949.1| putative VHS/GAT domain containing family protein [Zea mays] Length = 212 Score = 60.5 bits (145), Expect = 2e-07 Identities = 24/33 (72%), Positives = 31/33 (93%) Frame = +3 Query: 180 MAGALVDRATSDMLVGPDWSINLEICDVLNHEP 278 M+ A+V+RATSDML+GPDW++NLEICD+LN EP Sbjct: 1 MSSAMVERATSDMLIGPDWAMNLEICDILNREP 33 >ref|NP_001147567.1| VHS and GAT domain protein [Zea mays] gi|195612234|gb|ACG27947.1| VHS and GAT domain protein [Zea mays] gi|413936397|gb|AFW70948.1| putative VHS/GAT domain containing family protein [Zea mays] Length = 665 Score = 60.5 bits (145), Expect = 2e-07 Identities = 24/33 (72%), Positives = 31/33 (93%) Frame = +3 Query: 180 MAGALVDRATSDMLVGPDWSINLEICDVLNHEP 278 M+ A+V+RATSDML+GPDW++NLEICD+LN EP Sbjct: 1 MSSAMVERATSDMLIGPDWAMNLEICDILNREP 33 >ref|XP_006643942.1| PREDICTED: TOM1-like protein 1-like [Oryza brachyantha] Length = 724 Score = 60.1 bits (144), Expect = 3e-07 Identities = 24/33 (72%), Positives = 30/33 (90%) Frame = +3 Query: 180 MAGALVDRATSDMLVGPDWSINLEICDVLNHEP 278 MAGA+VDRATSDML+GPDW+ N+EICD+ N +P Sbjct: 1 MAGAMVDRATSDMLIGPDWAKNMEICDICNRDP 33 >gb|EMT25957.1| TOM1-like protein 2 [Aegilops tauschii] Length = 723 Score = 60.1 bits (144), Expect = 3e-07 Identities = 24/33 (72%), Positives = 30/33 (90%) Frame = +3 Query: 180 MAGALVDRATSDMLVGPDWSINLEICDVLNHEP 278 MAGA+VDRATSDML+GPDW+ N+EICD+ N +P Sbjct: 1 MAGAMVDRATSDMLIGPDWAKNMEICDICNRDP 33 >gb|EXB82271.1| Protein PEROXIN-4 [Morus notabilis] Length = 905 Score = 59.3 bits (142), Expect = 5e-07 Identities = 22/33 (66%), Positives = 31/33 (93%) Frame = +3 Query: 180 MAGALVDRATSDMLVGPDWSINLEICDVLNHEP 278 M ++V+RATSDML+GPDW++N+EICD+LNH+P Sbjct: 1 MVNSMVERATSDMLIGPDWAMNIEICDMLNHDP 33 >gb|ESW33366.1| hypothetical protein PHAVU_001G063400g [Phaseolus vulgaris] Length = 662 Score = 59.3 bits (142), Expect = 5e-07 Identities = 22/33 (66%), Positives = 31/33 (93%) Frame = +3 Query: 180 MAGALVDRATSDMLVGPDWSINLEICDVLNHEP 278 M ++V+RATSDML+GPDW++N+EICD+LNH+P Sbjct: 1 MVNSMVERATSDMLIGPDWAMNIEICDMLNHDP 33 >ref|XP_004952188.1| PREDICTED: target of Myb protein 1-like [Setaria italica] Length = 643 Score = 59.3 bits (142), Expect = 5e-07 Identities = 23/33 (69%), Positives = 31/33 (93%) Frame = +3 Query: 180 MAGALVDRATSDMLVGPDWSINLEICDVLNHEP 278 M+ A+V+RATSDML+GPDW++NLEICD+LN +P Sbjct: 1 MSSAMVERATSDMLIGPDWAMNLEICDILNRDP 33 >ref|XP_004498477.1| PREDICTED: TOM1-like protein 1-like [Cicer arietinum] Length = 662 Score = 59.3 bits (142), Expect = 5e-07 Identities = 22/33 (66%), Positives = 31/33 (93%) Frame = +3 Query: 180 MAGALVDRATSDMLVGPDWSINLEICDVLNHEP 278 M ++V+RATSDML+GPDW++N+EICD+LNH+P Sbjct: 1 MVNSMVERATSDMLIGPDWAMNIEICDMLNHDP 33 >ref|NP_001237269.1| VHS and GAT domain protein [Glycine max] gi|82791812|gb|ABB90835.1| VHS and GAT domain protein [Glycine max] Length = 672 Score = 59.3 bits (142), Expect = 5e-07 Identities = 22/33 (66%), Positives = 31/33 (93%) Frame = +3 Query: 180 MAGALVDRATSDMLVGPDWSINLEICDVLNHEP 278 M ++V+RATSDML+GPDW++N+EICD+LNH+P Sbjct: 1 MVNSMVERATSDMLIGPDWAMNIEICDMLNHDP 33 >ref|XP_003631826.1| PREDICTED: uncharacterized protein LOC100249280 isoform 2 [Vitis vinifera] Length = 663 Score = 59.3 bits (142), Expect = 5e-07 Identities = 22/33 (66%), Positives = 31/33 (93%) Frame = +3 Query: 180 MAGALVDRATSDMLVGPDWSINLEICDVLNHEP 278 M ++V+RATSDML+GPDW++N+EICD+LNH+P Sbjct: 1 MVNSMVERATSDMLIGPDWAMNIEICDMLNHDP 33 >ref|XP_003544671.1| PREDICTED: TOM1-like protein 2-like [Glycine max] Length = 672 Score = 59.3 bits (142), Expect = 5e-07 Identities = 22/33 (66%), Positives = 31/33 (93%) Frame = +3 Query: 180 MAGALVDRATSDMLVGPDWSINLEICDVLNHEP 278 M ++V+RATSDML+GPDW++N+EICD+LNH+P Sbjct: 1 MVNSMVERATSDMLIGPDWAMNIEICDMLNHDP 33 >ref|XP_002284083.2| PREDICTED: uncharacterized protein LOC100249280 isoform 1 [Vitis vinifera] gi|296081876|emb|CBI20881.3| unnamed protein product [Vitis vinifera] Length = 691 Score = 59.3 bits (142), Expect = 5e-07 Identities = 22/33 (66%), Positives = 31/33 (93%) Frame = +3 Query: 180 MAGALVDRATSDMLVGPDWSINLEICDVLNHEP 278 M ++V+RATSDML+GPDW++N+EICD+LNH+P Sbjct: 1 MVNSMVERATSDMLIGPDWAMNIEICDMLNHDP 33 >ref|XP_002453673.1| hypothetical protein SORBIDRAFT_04g010220 [Sorghum bicolor] gi|241933504|gb|EES06649.1| hypothetical protein SORBIDRAFT_04g010220 [Sorghum bicolor] Length = 625 Score = 59.3 bits (142), Expect = 5e-07 Identities = 23/33 (69%), Positives = 31/33 (93%) Frame = +3 Query: 180 MAGALVDRATSDMLVGPDWSINLEICDVLNHEP 278 M+ A+V+RATSDML+GPDW++NLEICD++N EP Sbjct: 1 MSSAMVERATSDMLIGPDWAMNLEICDIVNREP 33