BLASTX nr result
ID: Zingiber25_contig00014397
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00014397 (522 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004960701.1| PREDICTED: skin secretory protein xP2-like [... 56 6e-06 >ref|XP_004960701.1| PREDICTED: skin secretory protein xP2-like [Setaria italica] Length = 335 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/42 (64%), Positives = 30/42 (71%), Gaps = 5/42 (11%) Frame = +1 Query: 10 MERRGGCCID-----VYGRGDAAAAWRMGRIMLRFRPIAPKP 120 MER+GGCCI G A AAW+MGRIML+FRPIAPKP Sbjct: 1 MERKGGCCIAPRYGAAAGGQQAGAAWQMGRIMLKFRPIAPKP 42