BLASTX nr result
ID: Zingiber25_contig00014377
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00014377 (264 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528147.1| rhythmically-expressed protein 2 protein, pu... 75 9e-12 ref|XP_006398102.1| hypothetical protein EUTSA_v10001002mg [Eutr... 69 5e-10 ref|XP_004293838.1| PREDICTED: haloacid dehalogenase-like hydrol... 69 5e-10 ref|XP_002303713.1| haloacid dehalogenase-like hydrolase family ... 69 5e-10 gb|EMJ13097.1| hypothetical protein PRUPE_ppa010330mg [Prunus pe... 69 9e-10 ref|XP_002273965.1| PREDICTED: haloacid dehalogenase-like hydrol... 69 9e-10 gb|EOX96830.1| Rhythmically-expressed protein 2 protein, putativ... 68 1e-09 ref|XP_004134528.1| PREDICTED: haloacid dehalogenase-like hydrol... 68 1e-09 ref|NP_199286.1| haloacid dehalogenase-like hydrolase domain-con... 68 1e-09 ref|XP_006281440.1| hypothetical protein CARUB_v10027516mg [Caps... 68 1e-09 ref|XP_002863548.1| hypothetical protein ARALYDRAFT_494510 [Arab... 68 1e-09 ref|XP_006853492.1| hypothetical protein AMTR_s00032p00212660 [A... 67 2e-09 ref|XP_006363179.1| PREDICTED: haloacid dehalogenase-like hydrol... 67 3e-09 ref|XP_004487904.1| PREDICTED: haloacid dehalogenase-like hydrol... 67 3e-09 ref|XP_004487903.1| PREDICTED: haloacid dehalogenase-like hydrol... 67 3e-09 ref|XP_004487901.1| PREDICTED: haloacid dehalogenase-like hydrol... 67 3e-09 ref|XP_004232630.1| PREDICTED: haloacid dehalogenase-like hydrol... 67 3e-09 ref|XP_004232629.1| PREDICTED: haloacid dehalogenase-like hydrol... 67 3e-09 gb|ADE77721.1| unknown [Picea sitchensis] 67 3e-09 ref|XP_006468570.1| PREDICTED: haloacid dehalogenase-like hydrol... 66 4e-09 >ref|XP_002528147.1| rhythmically-expressed protein 2 protein, putative [Ricinus communis] gi|223532445|gb|EEF34238.1| rhythmically-expressed protein 2 protein, putative [Ricinus communis] Length = 279 Score = 75.1 bits (183), Expect = 9e-12 Identities = 39/61 (63%), Positives = 49/61 (80%) Frame = -3 Query: 184 LFSPGDGCVSI*FLDFASVRNNSSTIAIMSMLSKLRCITVDVTGTLIAYKGELGDYYCMA 5 + + G+ VS+ F ++S ++ IA+MS+LSKLRCITVDVTGTLIAYKGELGDYYCMA Sbjct: 1 MLASGEIEVSLLFTIWSSCE--TAAIAVMSLLSKLRCITVDVTGTLIAYKGELGDYYCMA 58 Query: 4 A 2 A Sbjct: 59 A 59 >ref|XP_006398102.1| hypothetical protein EUTSA_v10001002mg [Eutrema salsugineum] gi|557099191|gb|ESQ39555.1| hypothetical protein EUTSA_v10001002mg [Eutrema salsugineum] Length = 252 Score = 69.3 bits (168), Expect = 5e-10 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -3 Query: 100 MSMLSKLRCITVDVTGTLIAYKGELGDYYCMAA 2 MS+LSKLRCITVDVTGTLIAYKGELGDYYCMAA Sbjct: 1 MSLLSKLRCITVDVTGTLIAYKGELGDYYCMAA 33 >ref|XP_004293838.1| PREDICTED: haloacid dehalogenase-like hydrolase domain-containing protein 3-like [Fragaria vesca subsp. vesca] Length = 253 Score = 69.3 bits (168), Expect = 5e-10 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -3 Query: 100 MSMLSKLRCITVDVTGTLIAYKGELGDYYCMAA 2 MS+LSKLRCITVDVTGTLIAYKGELGDYYCMAA Sbjct: 1 MSLLSKLRCITVDVTGTLIAYKGELGDYYCMAA 33 >ref|XP_002303713.1| haloacid dehalogenase-like hydrolase family protein [Populus trichocarpa] gi|222841145|gb|EEE78692.1| haloacid dehalogenase-like hydrolase family protein [Populus trichocarpa] Length = 257 Score = 69.3 bits (168), Expect = 5e-10 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -3 Query: 100 MSMLSKLRCITVDVTGTLIAYKGELGDYYCMAA 2 MS+LSKLRCITVDVTGTLIAYKGELGDYYCMAA Sbjct: 1 MSLLSKLRCITVDVTGTLIAYKGELGDYYCMAA 33 >gb|EMJ13097.1| hypothetical protein PRUPE_ppa010330mg [Prunus persica] Length = 253 Score = 68.6 bits (166), Expect = 9e-10 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -3 Query: 100 MSMLSKLRCITVDVTGTLIAYKGELGDYYCMAA 2 MS+LSKLRCITVDVTGTL+AYKGELGDYYCMAA Sbjct: 1 MSLLSKLRCITVDVTGTLLAYKGELGDYYCMAA 33 >ref|XP_002273965.1| PREDICTED: haloacid dehalogenase-like hydrolase domain-containing-like isoform 2 [Vitis vinifera] gi|225423597|ref|XP_002273939.1| PREDICTED: haloacid dehalogenase-like hydrolase domain-containing-like isoform 1 [Vitis vinifera] gi|297738028|emb|CBI27229.3| unnamed protein product [Vitis vinifera] Length = 250 Score = 68.6 bits (166), Expect = 9e-10 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = -3 Query: 100 MSMLSKLRCITVDVTGTLIAYKGELGDYYCMAA 2 MSMLSKLRCIT DVTGTLIAYKGELGDYYCMAA Sbjct: 1 MSMLSKLRCITFDVTGTLIAYKGELGDYYCMAA 33 >gb|EOX96830.1| Rhythmically-expressed protein 2 protein, putative isoform 1 [Theobroma cacao] gi|508704935|gb|EOX96831.1| Rhythmically-expressed protein 2 protein, putative isoform 1 [Theobroma cacao] gi|508704936|gb|EOX96832.1| Rhythmically-expressed protein 2 protein, putative isoform 1 [Theobroma cacao] Length = 253 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -3 Query: 100 MSMLSKLRCITVDVTGTLIAYKGELGDYYCMAA 2 MS+LS+LRCITVDVTGTLIAYKGELGDYYCMAA Sbjct: 1 MSLLSRLRCITVDVTGTLIAYKGELGDYYCMAA 33 >ref|XP_004134528.1| PREDICTED: haloacid dehalogenase-like hydrolase domain-containing protein 3-like [Cucumis sativus] Length = 249 Score = 68.2 bits (165), Expect = 1e-09 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -3 Query: 100 MSMLSKLRCITVDVTGTLIAYKGELGDYYCMAA 2 MS+LSKLRCIT+DVTGTL+AYKGELGDYYCMAA Sbjct: 1 MSLLSKLRCITIDVTGTLLAYKGELGDYYCMAA 33 >ref|NP_199286.1| haloacid dehalogenase-like hydrolase domain-containing protein [Arabidopsis thaliana] gi|42573575|ref|NP_974884.1| haloacid dehalogenase-like hydrolase domain-containing protein [Arabidopsis thaliana] gi|2660676|gb|AAC79147.1| Dreg-2 like protein [Arabidopsis thaliana] gi|9758377|dbj|BAB08826.1| Dreg-2 like protein [Arabidopsis thaliana] gi|106879171|gb|ABF82615.1| At5g44730 [Arabidopsis thaliana] gi|332007769|gb|AED95152.1| haloacid dehalogenase-like hydrolase domain-containing protein [Arabidopsis thaliana] gi|332007770|gb|AED95153.1| haloacid dehalogenase-like hydrolase domain-containing protein [Arabidopsis thaliana] Length = 255 Score = 67.8 bits (164), Expect = 1e-09 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -3 Query: 100 MSMLSKLRCITVDVTGTLIAYKGELGDYYCMAA 2 +S+LSKLRCITVDVTGTLIAYKGELGDYYCMAA Sbjct: 3 VSLLSKLRCITVDVTGTLIAYKGELGDYYCMAA 35 >ref|XP_006281440.1| hypothetical protein CARUB_v10027516mg [Capsella rubella] gi|482550144|gb|EOA14338.1| hypothetical protein CARUB_v10027516mg [Capsella rubella] Length = 254 Score = 67.8 bits (164), Expect = 1e-09 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -3 Query: 100 MSMLSKLRCITVDVTGTLIAYKGELGDYYCMAA 2 +S+LSKLRCITVDVTGTLIAYKGELGDYYCMAA Sbjct: 3 VSLLSKLRCITVDVTGTLIAYKGELGDYYCMAA 35 >ref|XP_002863548.1| hypothetical protein ARALYDRAFT_494510 [Arabidopsis lyrata subsp. lyrata] gi|297309383|gb|EFH39807.1| hypothetical protein ARALYDRAFT_494510 [Arabidopsis lyrata subsp. lyrata] Length = 254 Score = 67.8 bits (164), Expect = 1e-09 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -3 Query: 100 MSMLSKLRCITVDVTGTLIAYKGELGDYYCMAA 2 +S+LSKLRCITVDVTGTLIAYKGELGDYYCMAA Sbjct: 3 VSLLSKLRCITVDVTGTLIAYKGELGDYYCMAA 35 >ref|XP_006853492.1| hypothetical protein AMTR_s00032p00212660 [Amborella trichopoda] gi|548857145|gb|ERN14959.1| hypothetical protein AMTR_s00032p00212660 [Amborella trichopoda] Length = 261 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -3 Query: 100 MSMLSKLRCITVDVTGTLIAYKGELGDYYCMAA 2 MS +SKLRCITVDVTGTLIAYKGELGDYYCMAA Sbjct: 1 MSSISKLRCITVDVTGTLIAYKGELGDYYCMAA 33 >ref|XP_006363179.1| PREDICTED: haloacid dehalogenase-like hydrolase domain-containing protein 3-like [Solanum tuberosum] Length = 256 Score = 66.6 bits (161), Expect = 3e-09 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -3 Query: 100 MSMLSKLRCITVDVTGTLIAYKGELGDYYCMAA 2 MS+L+KLRCIT+DVTGTLIAYKGELGDYYCMAA Sbjct: 1 MSILTKLRCITLDVTGTLIAYKGELGDYYCMAA 33 >ref|XP_004487904.1| PREDICTED: haloacid dehalogenase-like hydrolase domain-containing protein 3-like isoform X4 [Cicer arietinum] Length = 283 Score = 66.6 bits (161), Expect = 3e-09 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -3 Query: 106 AIMSMLSKLRCITVDVTGTLIAYKGELGDYYCMAA 2 A MS+L KLRC+TVDVTGTL+AYKGELGDYYCMAA Sbjct: 29 ATMSILPKLRCVTVDVTGTLMAYKGELGDYYCMAA 63 >ref|XP_004487903.1| PREDICTED: haloacid dehalogenase-like hydrolase domain-containing protein 3-like isoform X3 [Cicer arietinum] Length = 307 Score = 66.6 bits (161), Expect = 3e-09 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -3 Query: 106 AIMSMLSKLRCITVDVTGTLIAYKGELGDYYCMAA 2 A MS+L KLRC+TVDVTGTL+AYKGELGDYYCMAA Sbjct: 53 ATMSILPKLRCVTVDVTGTLMAYKGELGDYYCMAA 87 >ref|XP_004487901.1| PREDICTED: haloacid dehalogenase-like hydrolase domain-containing protein 3-like isoform X1 [Cicer arietinum] gi|502085375|ref|XP_004487902.1| PREDICTED: haloacid dehalogenase-like hydrolase domain-containing protein 3-like isoform X2 [Cicer arietinum] Length = 340 Score = 66.6 bits (161), Expect = 3e-09 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -3 Query: 106 AIMSMLSKLRCITVDVTGTLIAYKGELGDYYCMAA 2 A MS+L KLRC+TVDVTGTL+AYKGELGDYYCMAA Sbjct: 86 ATMSILPKLRCVTVDVTGTLMAYKGELGDYYCMAA 120 >ref|XP_004232630.1| PREDICTED: haloacid dehalogenase-like hydrolase domain-containing protein 3-like isoform 2 [Solanum lycopersicum] Length = 256 Score = 66.6 bits (161), Expect = 3e-09 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -3 Query: 100 MSMLSKLRCITVDVTGTLIAYKGELGDYYCMAA 2 MS+L+KLRCIT+DVTGTLIAYKGELGDYYCMAA Sbjct: 1 MSILTKLRCITLDVTGTLIAYKGELGDYYCMAA 33 >ref|XP_004232629.1| PREDICTED: haloacid dehalogenase-like hydrolase domain-containing protein 3-like isoform 1 [Solanum lycopersicum] Length = 306 Score = 66.6 bits (161), Expect = 3e-09 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -3 Query: 100 MSMLSKLRCITVDVTGTLIAYKGELGDYYCMAA 2 MS+L+KLRCIT+DVTGTLIAYKGELGDYYCMAA Sbjct: 51 MSILTKLRCITLDVTGTLIAYKGELGDYYCMAA 83 >gb|ADE77721.1| unknown [Picea sitchensis] Length = 254 Score = 66.6 bits (161), Expect = 3e-09 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = -3 Query: 100 MSMLSKLRCITVDVTGTLIAYKGELGDYYCMAA 2 M++LSKLRCIT+DVTGTLIAYKGELGDYYC+AA Sbjct: 1 MALLSKLRCITIDVTGTLIAYKGELGDYYCLAA 33 >ref|XP_006468570.1| PREDICTED: haloacid dehalogenase-like hydrolase domain-containing protein 3-like isoform X1 [Citrus sinensis] Length = 253 Score = 66.2 bits (160), Expect = 4e-09 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = -3 Query: 100 MSMLSKLRCITVDVTGTLIAYKGELGDYYCMAA 2 M++LS+LRCITVDVTGTL+AYKGELGDYYCMAA Sbjct: 1 MALLSRLRCITVDVTGTLLAYKGELGDYYCMAA 33