BLASTX nr result
ID: Zingiber25_contig00014324
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00014324 (329 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006346641.1| PREDICTED: probable ADP-ribosylation factor ... 155 7e-36 ref|XP_006451620.1| hypothetical protein CICLE_v10009524mg [Citr... 154 2e-35 gb|EOY21345.1| Calcium-dependent lipid-binding (CaLB domain) fam... 154 2e-35 ref|XP_004252274.1| PREDICTED: probable ADP-ribosylation factor ... 154 2e-35 ref|XP_006490774.1| PREDICTED: probable ADP-ribosylation factor ... 153 2e-35 ref|XP_006341525.1| PREDICTED: probable ADP-ribosylation factor ... 153 2e-35 ref|XP_004235814.1| PREDICTED: probable ADP-ribosylation factor ... 153 2e-35 ref|XP_004235813.1| PREDICTED: probable ADP-ribosylation factor ... 153 2e-35 ref|XP_003534141.2| PREDICTED: probable ADP-ribosylation factor ... 153 3e-35 ref|XP_006587472.1| PREDICTED: probable ADP-ribosylation factor ... 153 3e-35 gb|ACD40011.1| pollen-specific C2 domain containing protein [Nic... 153 3e-35 gb|ACD40010.1| pollen-specific C2 domain containing protein [Nic... 153 3e-35 dbj|BAO02515.1| predicted C2 domain containing protein [Nicotian... 152 3e-35 ref|XP_004137344.1| PREDICTED: probable ADP-ribosylation factor ... 152 3e-35 gb|ACD40015.1| pollen-specific C2 domain containing protein [Nic... 152 4e-35 ref|XP_002461315.1| hypothetical protein SORBIDRAFT_02g000790 [S... 151 8e-35 gb|ACD40017.1| pollen-specific C2 domain containing protein [Nic... 151 8e-35 ref|XP_006584907.1| PREDICTED: probable ADP-ribosylation factor ... 151 1e-34 ref|XP_002534010.1| ARF GTPase activator, putative [Ricinus comm... 151 1e-34 gb|ESW35385.1| hypothetical protein PHAVU_001G230800g [Phaseolus... 150 1e-34 >ref|XP_006346641.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating protein AGD11-like [Solanum tuberosum] Length = 181 Score = 155 bits (391), Expect = 7e-36 Identities = 74/108 (68%), Positives = 88/108 (81%) Frame = +1 Query: 4 WNEDLTLTVSDPIHPLKLQVFDKDLFSRDDKMGDAEIDIHSFVEATKLNLSNIPNGTVIT 183 WNEDLTL+VSDP P+KL V+D D FS DDKMGDAE DI SFVEA K+NL +P+GTVIT Sbjct: 68 WNEDLTLSVSDPSLPVKLTVYDHDTFSMDDKMGDAEFDIKSFVEALKMNLHGLPSGTVIT 127 Query: 184 TVRPNRHNCLADESAIVWRDGTVVQDIIVRLKNVESGELELQLSWINL 327 V P R NCLA+ES ++W DG VVQD+I+RL+NVE GE+ELQL WI+L Sbjct: 128 RVLPCRTNCLAEESRVIWDDGKVVQDMILRLRNVECGEVELQLQWIDL 175 >ref|XP_006451620.1| hypothetical protein CICLE_v10009524mg [Citrus clementina] gi|557554846|gb|ESR64860.1| hypothetical protein CICLE_v10009524mg [Citrus clementina] Length = 202 Score = 154 bits (388), Expect = 2e-35 Identities = 65/108 (60%), Positives = 92/108 (85%) Frame = +1 Query: 4 WNEDLTLTVSDPIHPLKLQVFDKDLFSRDDKMGDAEIDIHSFVEATKLNLSNIPNGTVIT 183 WNEDLTL+++DP P+ L V+D DLFS+DD+MGDAE DI +++EA K+NL ++P GT+I+ Sbjct: 89 WNEDLTLSITDPNVPITLTVYDHDLFSKDDRMGDAEFDIKTYIEALKMNLDSLPTGTIIS 148 Query: 184 TVRPNRHNCLADESAIVWRDGTVVQDIIVRLKNVESGELELQLSWINL 327 V P+RHNCL+++S +VW++G VVQD+I+RL+NVE GELE+QL WI+L Sbjct: 149 RVMPSRHNCLSEQSCVVWKEGKVVQDLILRLRNVECGELEIQLQWIDL 196 >gb|EOY21345.1| Calcium-dependent lipid-binding (CaLB domain) family protein [Theobroma cacao] Length = 181 Score = 154 bits (388), Expect = 2e-35 Identities = 68/108 (62%), Positives = 90/108 (83%) Frame = +1 Query: 4 WNEDLTLTVSDPIHPLKLQVFDKDLFSRDDKMGDAEIDIHSFVEATKLNLSNIPNGTVIT 183 WNEDLTL+++DP P+KL V+D D FS+DDKMGDAE DI +++EA K+NL IP+GT+I+ Sbjct: 68 WNEDLTLSITDPSLPIKLTVYDHDTFSKDDKMGDAEFDIRTYIEALKMNLGEIPSGTIIS 127 Query: 184 TVRPNRHNCLADESAIVWRDGTVVQDIIVRLKNVESGELELQLSWINL 327 V+P R+NCLA+ES I W+DG VVQDI +RL+NVE GE+E+QL WI+L Sbjct: 128 KVQPGRNNCLAEESTIDWKDGKVVQDICLRLRNVECGEVEIQLQWIDL 175 >ref|XP_004252274.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating protein AGD11-like [Solanum lycopersicum] Length = 178 Score = 154 bits (388), Expect = 2e-35 Identities = 73/108 (67%), Positives = 88/108 (81%) Frame = +1 Query: 4 WNEDLTLTVSDPIHPLKLQVFDKDLFSRDDKMGDAEIDIHSFVEATKLNLSNIPNGTVIT 183 WNEDLTL+VSDP P+KL V+D D F+ DDKMGDAE DI SFVEA K+NL +P+GTVIT Sbjct: 65 WNEDLTLSVSDPSLPVKLTVYDHDTFTMDDKMGDAEFDIKSFVEALKMNLHGLPSGTVIT 124 Query: 184 TVRPNRHNCLADESAIVWRDGTVVQDIIVRLKNVESGELELQLSWINL 327 V P R NCLA+ES ++W DG VVQD+I+RL+NVE GE+ELQL WI+L Sbjct: 125 RVLPCRTNCLAEESRVIWDDGKVVQDMILRLRNVECGEVELQLQWIDL 172 >ref|XP_006490774.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating protein AGD11-like [Citrus sinensis] Length = 202 Score = 153 bits (387), Expect = 2e-35 Identities = 64/108 (59%), Positives = 92/108 (85%) Frame = +1 Query: 4 WNEDLTLTVSDPIHPLKLQVFDKDLFSRDDKMGDAEIDIHSFVEATKLNLSNIPNGTVIT 183 WNEDLTL+++DP P+ L V+D DLFS+DD+MGDAE DI +++EA K+NL ++P GT+I+ Sbjct: 89 WNEDLTLSITDPNVPITLTVYDHDLFSKDDRMGDAEFDIKTYIEALKMNLDSLPTGTIIS 148 Query: 184 TVRPNRHNCLADESAIVWRDGTVVQDIIVRLKNVESGELELQLSWINL 327 V P+RHNCL+++S +VW++G VVQD+++RL+NVE GELE+QL WI+L Sbjct: 149 RVMPSRHNCLSEQSCVVWKEGKVVQDLVLRLRNVECGELEIQLQWIDL 196 >ref|XP_006341525.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating protein AGD13-like [Solanum tuberosum] Length = 165 Score = 153 bits (387), Expect = 2e-35 Identities = 69/108 (63%), Positives = 89/108 (82%) Frame = +1 Query: 4 WNEDLTLTVSDPIHPLKLQVFDKDLFSRDDKMGDAEIDIHSFVEATKLNLSNIPNGTVIT 183 WNEDLTL+V+DP P+ L V+D D+FS+DDKMGDAE DI F+EA K+NLS +P GT+IT Sbjct: 52 WNEDLTLSVADPNLPVMLTVYDHDMFSKDDKMGDAEFDIRPFLEALKMNLSGLPGGTIIT 111 Query: 184 TVRPNRHNCLADESAIVWRDGTVVQDIIVRLKNVESGELELQLSWINL 327 ++P R NCL++ES +VW+DG VVQD+ +RL+NVE GE+ELQL WINL Sbjct: 112 RIQPCRSNCLSEESNVVWQDGQVVQDMCLRLRNVECGEIELQLQWINL 159 >ref|XP_004235814.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating protein AGD13-like isoform 3 [Solanum lycopersicum] Length = 165 Score = 153 bits (387), Expect = 2e-35 Identities = 69/108 (63%), Positives = 89/108 (82%) Frame = +1 Query: 4 WNEDLTLTVSDPIHPLKLQVFDKDLFSRDDKMGDAEIDIHSFVEATKLNLSNIPNGTVIT 183 WNEDLTL+V+DP P+ L V+D D+FS+DDKMGDAE DI F+EA K+NLS +P GT+IT Sbjct: 52 WNEDLTLSVADPNLPVMLTVYDHDIFSKDDKMGDAEFDIRPFLEALKMNLSGLPGGTIIT 111 Query: 184 TVRPNRHNCLADESAIVWRDGTVVQDIIVRLKNVESGELELQLSWINL 327 ++P R NCL++ES +VW+DG VVQD+ +RL+NVE GE+ELQL WINL Sbjct: 112 RIQPCRSNCLSEESNVVWQDGQVVQDMCLRLRNVECGEIELQLQWINL 159 >ref|XP_004235813.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating protein AGD13-like isoform 2 [Solanum lycopersicum] Length = 165 Score = 153 bits (387), Expect = 2e-35 Identities = 69/108 (63%), Positives = 89/108 (82%) Frame = +1 Query: 4 WNEDLTLTVSDPIHPLKLQVFDKDLFSRDDKMGDAEIDIHSFVEATKLNLSNIPNGTVIT 183 WNEDLTL+V+DP P+ L V+D D+FS+DDKMGDAE DI F+EA K+NLS +P GT+IT Sbjct: 52 WNEDLTLSVADPNLPVMLTVYDHDIFSKDDKMGDAEFDIRPFLEALKMNLSGLPGGTIIT 111 Query: 184 TVRPNRHNCLADESAIVWRDGTVVQDIIVRLKNVESGELELQLSWINL 327 ++P R NCL++ES +VW+DG VVQD+ +RL+NVE GE+ELQL WINL Sbjct: 112 RIQPCRSNCLSEESNVVWQDGQVVQDMCLRLRNVECGEIELQLQWINL 159 >ref|XP_003534141.2| PREDICTED: probable ADP-ribosylation factor GTPase-activating protein AGD13 isoform X1 [Glycine max] Length = 204 Score = 153 bits (386), Expect = 3e-35 Identities = 68/108 (62%), Positives = 90/108 (83%) Frame = +1 Query: 4 WNEDLTLTVSDPIHPLKLQVFDKDLFSRDDKMGDAEIDIHSFVEATKLNLSNIPNGTVIT 183 WNEDLTL+V +P H +KL V+D D FS+DDKMGDAE DI F+EA K+NL+ +PNGTV+T Sbjct: 91 WNEDLTLSVINPNHKIKLTVYDHDTFSKDDKMGDAEFDIFPFIEALKMNLTGLPNGTVVT 150 Query: 184 TVRPNRHNCLADESAIVWRDGTVVQDIIVRLKNVESGELELQLSWINL 327 ++P++HNCLADES I + +G VVQD+I+RL+NVE GE+E+QL WI+L Sbjct: 151 RIQPSKHNCLADESCITYSNGKVVQDMILRLQNVECGEVEIQLQWIDL 198 >ref|XP_006587472.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating protein AGD13 isoform X2 [Glycine max] Length = 176 Score = 153 bits (386), Expect = 3e-35 Identities = 68/108 (62%), Positives = 90/108 (83%) Frame = +1 Query: 4 WNEDLTLTVSDPIHPLKLQVFDKDLFSRDDKMGDAEIDIHSFVEATKLNLSNIPNGTVIT 183 WNEDLTL+V +P H +KL V+D D FS+DDKMGDAE DI F+EA K+NL+ +PNGTV+T Sbjct: 63 WNEDLTLSVINPNHKIKLTVYDHDTFSKDDKMGDAEFDIFPFIEALKMNLTGLPNGTVVT 122 Query: 184 TVRPNRHNCLADESAIVWRDGTVVQDIIVRLKNVESGELELQLSWINL 327 ++P++HNCLADES I + +G VVQD+I+RL+NVE GE+E+QL WI+L Sbjct: 123 RIQPSKHNCLADESCITYSNGKVVQDMILRLQNVECGEVEIQLQWIDL 170 >gb|ACD40011.1| pollen-specific C2 domain containing protein [Nicotiana sp. variant 'Rastroensis'] Length = 188 Score = 153 bits (386), Expect = 3e-35 Identities = 73/108 (67%), Positives = 87/108 (80%) Frame = +1 Query: 4 WNEDLTLTVSDPIHPLKLQVFDKDLFSRDDKMGDAEIDIHSFVEATKLNLSNIPNGTVIT 183 WNE+LTL+VSDP P+KL V+D D FS DDKMGDAE DI FVEA K+NL +P+GTVIT Sbjct: 75 WNEELTLSVSDPSLPVKLTVYDHDTFSMDDKMGDAEFDIKPFVEALKMNLDGLPSGTVIT 134 Query: 184 TVRPNRHNCLADESAIVWRDGTVVQDIIVRLKNVESGELELQLSWINL 327 V P R NCLA+ES +VW+DG VVQD+I+RL+NVE GE+ELQL WI L Sbjct: 135 RVLPCRTNCLAEESRVVWQDGKVVQDMILRLRNVECGEVELQLQWIEL 182 >gb|ACD40010.1| pollen-specific C2 domain containing protein [Nicotiana alata] gi|187942407|gb|ACD40012.1| pollen-specific C2 domain containing protein [Nicotiana forgetiana] gi|187942409|gb|ACD40013.1| pollen-specific C2 domain containing protein [Nicotiana langsdorffii] gi|187942411|gb|ACD40014.1| pollen-specific C2 domain containing protein [Nicotiana mutabilis] gi|187942415|gb|ACD40016.1| pollen-specific C2 domain containing protein [Nicotiana longiflora] Length = 187 Score = 153 bits (386), Expect = 3e-35 Identities = 73/108 (67%), Positives = 87/108 (80%) Frame = +1 Query: 4 WNEDLTLTVSDPIHPLKLQVFDKDLFSRDDKMGDAEIDIHSFVEATKLNLSNIPNGTVIT 183 WNE+LTL+VSDP P+KL V+D D FS DDKMGDAE DI FVEA K+NL +P+GTVIT Sbjct: 74 WNEELTLSVSDPSLPVKLTVYDHDTFSMDDKMGDAEFDIKPFVEALKMNLDGLPSGTVIT 133 Query: 184 TVRPNRHNCLADESAIVWRDGTVVQDIIVRLKNVESGELELQLSWINL 327 V P R NCLA+ES +VW+DG VVQD+I+RL+NVE GE+ELQL WI L Sbjct: 134 RVLPCRTNCLAEESRVVWQDGKVVQDMILRLRNVECGEVELQLQWIEL 181 >dbj|BAO02515.1| predicted C2 domain containing protein [Nicotiana alata] Length = 188 Score = 152 bits (385), Expect = 3e-35 Identities = 72/108 (66%), Positives = 87/108 (80%) Frame = +1 Query: 4 WNEDLTLTVSDPIHPLKLQVFDKDLFSRDDKMGDAEIDIHSFVEATKLNLSNIPNGTVIT 183 WNE+LTL+VSDP P+KL V+D D FS DDKMGDAE DI F+EA K+NL +P+GTVIT Sbjct: 75 WNEELTLSVSDPSLPVKLTVYDHDTFSMDDKMGDAEFDIKPFIEALKMNLDGLPSGTVIT 134 Query: 184 TVRPNRHNCLADESAIVWRDGTVVQDIIVRLKNVESGELELQLSWINL 327 V P R NCLA+ES +VW+DG VVQD+I+RL+NVE GE+ELQL WI L Sbjct: 135 RVLPCRTNCLAEESRVVWQDGKVVQDMILRLRNVECGEVELQLQWIEL 182 >ref|XP_004137344.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating protein AGD11-like [Cucumis sativus] gi|449497488|ref|XP_004160416.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating protein AGD11-like [Cucumis sativus] Length = 181 Score = 152 bits (385), Expect = 3e-35 Identities = 71/109 (65%), Positives = 88/109 (80%) Frame = +1 Query: 1 VWNEDLTLTVSDPIHPLKLQVFDKDLFSRDDKMGDAEIDIHSFVEATKLNLSNIPNGTVI 180 VWNEDLTL+VSDP P+KL V+D D FS+DDKMG AE DI +F+EA K+NL N+ +GT I Sbjct: 68 VWNEDLTLSVSDPNLPIKLTVYDHDTFSKDDKMGYAEFDIKAFMEALKMNLKNLSSGTTI 127 Query: 181 TTVRPNRHNCLADESAIVWRDGTVVQDIIVRLKNVESGELELQLSWINL 327 T + P R NCLA+ES +VW+DG VVQDI +RL+NVE GE+E+QL WINL Sbjct: 128 TRMLPARQNCLAEESCVVWKDGKVVQDIYLRLRNVECGEVEIQLQWINL 176 >gb|ACD40015.1| pollen-specific C2 domain containing protein [Nicotiana bonariensis] Length = 187 Score = 152 bits (384), Expect = 4e-35 Identities = 73/108 (67%), Positives = 87/108 (80%) Frame = +1 Query: 4 WNEDLTLTVSDPIHPLKLQVFDKDLFSRDDKMGDAEIDIHSFVEATKLNLSNIPNGTVIT 183 WNE+LTL+VSDP P+KL V+D D FS DDKMGDAE DI FVEA K+NL +P+GTVIT Sbjct: 74 WNEELTLSVSDPSLPVKLTVYDHDTFSMDDKMGDAEFDIKPFVEALKMNLYGLPSGTVIT 133 Query: 184 TVRPNRHNCLADESAIVWRDGTVVQDIIVRLKNVESGELELQLSWINL 327 V P R NCLA+ES +VW+DG VVQD+I+RL+NVE GE+ELQL WI L Sbjct: 134 RVLPCRTNCLAEESRVVWQDGKVVQDMILRLRNVECGEVELQLQWIEL 181 >ref|XP_002461315.1| hypothetical protein SORBIDRAFT_02g000790 [Sorghum bicolor] gi|241924692|gb|EER97836.1| hypothetical protein SORBIDRAFT_02g000790 [Sorghum bicolor] Length = 165 Score = 151 bits (382), Expect = 8e-35 Identities = 68/109 (62%), Positives = 87/109 (79%) Frame = +1 Query: 1 VWNEDLTLTVSDPIHPLKLQVFDKDLFSRDDKMGDAEIDIHSFVEATKLNLSNIPNGTVI 180 +W+E+LTLTV+DP PLKL+VFDKD FSRDD MGDAEID+ +EA +N I NG +I Sbjct: 51 IWHEELTLTVTDPSQPLKLEVFDKDTFSRDDPMGDAEIDVAPLIEAVNMNPEEIRNGAII 110 Query: 181 TTVRPNRHNCLADESAIVWRDGTVVQDIIVRLKNVESGELELQLSWINL 327 +VRP+ NCLADES + WR+G VQD+I+RLKNVESGE++LQL W+N+ Sbjct: 111 RSVRPSTKNCLADESHVCWRNGKFVQDMILRLKNVESGEIQLQLQWVNI 159 >gb|ACD40017.1| pollen-specific C2 domain containing protein [Nicotiana plumbaginifolia] Length = 179 Score = 151 bits (382), Expect = 8e-35 Identities = 72/106 (67%), Positives = 86/106 (81%) Frame = +1 Query: 4 WNEDLTLTVSDPIHPLKLQVFDKDLFSRDDKMGDAEIDIHSFVEATKLNLSNIPNGTVIT 183 WNE+LTL+VSDP P+KL V+D D FS DDKMGDAE DI FVEA K+NL +P+GTVIT Sbjct: 74 WNEELTLSVSDPSLPVKLTVYDHDTFSMDDKMGDAEFDIKPFVEALKMNLDGLPSGTVIT 133 Query: 184 TVRPNRHNCLADESAIVWRDGTVVQDIIVRLKNVESGELELQLSWI 321 V P R NCLA+ES +VW+DG VVQD+I+RL+NVE GE+ELQL WI Sbjct: 134 RVLPCRTNCLAEESRVVWQDGKVVQDMILRLRNVECGEVELQLQWI 179 >ref|XP_006584907.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating protein AGD13-like [Glycine max] Length = 165 Score = 151 bits (381), Expect = 1e-34 Identities = 65/108 (60%), Positives = 91/108 (84%) Frame = +1 Query: 4 WNEDLTLTVSDPIHPLKLQVFDKDLFSRDDKMGDAEIDIHSFVEATKLNLSNIPNGTVIT 183 W EDLTL+V+DPIHP L V+D D FS+DDKMGDAE DI +++EA K+NL ++P+GT+IT Sbjct: 52 WKEDLTLSVTDPIHPFILTVYDYDTFSKDDKMGDAECDISAYIEALKMNLEDLPSGTIIT 111 Query: 184 TVRPNRHNCLADESAIVWRDGTVVQDIIVRLKNVESGELELQLSWINL 327 ++P+R NCLA+ES I + +G V+QD+++RL++VESGE+E+QL WINL Sbjct: 112 RIQPSRQNCLAEESCITYSNGKVIQDLVLRLRHVESGEVEIQLQWINL 159 >ref|XP_002534010.1| ARF GTPase activator, putative [Ricinus communis] gi|223525988|gb|EEF28372.1| ARF GTPase activator, putative [Ricinus communis] Length = 169 Score = 151 bits (381), Expect = 1e-34 Identities = 65/108 (60%), Positives = 91/108 (84%) Frame = +1 Query: 4 WNEDLTLTVSDPIHPLKLQVFDKDLFSRDDKMGDAEIDIHSFVEATKLNLSNIPNGTVIT 183 WNEDLTL++S+P P+K+ V+D+D FSRDDKMGDAE DIH F+EA K++L +P+GT+IT Sbjct: 56 WNEDLTLSISNPNLPVKIGVYDRDTFSRDDKMGDAEFDIHPFLEALKMHLQGLPSGTIIT 115 Query: 184 TVRPNRHNCLADESAIVWRDGTVVQDIIVRLKNVESGELELQLSWINL 327 ++P+R NCLA+ES ++W DG VVQ++ +RL+NVE GE+ELQL WI++ Sbjct: 116 RIQPSRENCLAEESHVLWVDGKVVQNLFLRLRNVECGEIELQLQWIDI 163 >gb|ESW35385.1| hypothetical protein PHAVU_001G230800g [Phaseolus vulgaris] Length = 189 Score = 150 bits (380), Expect = 1e-34 Identities = 67/108 (62%), Positives = 89/108 (82%) Frame = +1 Query: 4 WNEDLTLTVSDPIHPLKLQVFDKDLFSRDDKMGDAEIDIHSFVEATKLNLSNIPNGTVIT 183 WN+DLTL++SDP P+ LQV+DKD FS DDKMGDA+ I F EA K+ L+ +PN T++T Sbjct: 76 WNDDLTLSISDPHTPIHLQVYDKDTFSMDDKMGDADFSIVPFTEAVKMRLAGLPNNTIVT 135 Query: 184 TVRPNRHNCLADESAIVWRDGTVVQDIIVRLKNVESGELELQLSWINL 327 V P+R NCLA+ES IVW+DG VVQ++++RLKNVESGE+ELQL+WI++ Sbjct: 136 KVLPSRQNCLAEESHIVWKDGKVVQNMVLRLKNVESGEVELQLNWIDI 183